Detailed information of TA system TA295980

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 120745..120999
• Replicon: plasmid P1
• Accession: NZ_OW968112
• Organism: Escherichia coli isolate 602

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: G9G1E3
• Locus tag: LQ120_RS23750
• Protein ID: WP_001312851.1
• Coordinates: 120850..120999 (+)
• Length: 50 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	120745..120806 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
LQ120_RS23725 (117493)	117493..118239	+	747	WP_000205749.1	conjugal transfer pilus acetylase TraX	-
LQ120_RS23730 (118298)	118298..119158	+	861	WP_000704514.1	alpha/beta hydrolase	-
LQ120_RS23735 (119261)	119261..119821	+	561	WP_000139315.1	fertility inhibition protein FinO	-
LQ120_RS23740 (119957)	119957..120169	+	213	WP_001299730.1	ANR family transcriptional regulator	-
LQ120_RS23745 (120415)	120415..120489	+	75	Protein_124	endonuclease	-
- (120745)	120745..120806	-	62	NuclAT_1	-	Antitoxin
- (120745)	120745..120806	-	62	NuclAT_1	-	Antitoxin
- (120745)	120745..120806	-	62	NuclAT_1	-	Antitoxin
- (120745)	120745..120806	-	62	NuclAT_1	-	Antitoxin
LQ120_RS23750 (120850)	120850..120999	+	150	WP_001312851.1	Hok/Gef family protein	Toxin
LQ120_RS23755 (121283)	121283..121540	+	258	WP_000083845.1	replication regulatory protein RepA	-
LQ120_RS23760 (121557)	121557..121808	-	252	WP_223195197.1	replication protein RepA	-
LQ120_RS23765 (121799)	121799..121846	+	48	WP_229471593.1	hypothetical protein	-
LQ120_RS23770 (121839)	121839..122321	+	483	WP_181726436.1	hypothetical protein	-
LQ120_RS23775 (122314)	122314..123171	+	858	WP_000774297.1	incFII family plasmid replication initiator RepA	-
LQ120_RS23780 (123872)	123872..124012	+	141	WP_001333237.1	hypothetical protein	-
LQ120_RS23785 (124110)	124110..124502	+	393	WP_000616804.1	histidine phosphatase family protein	-
LQ120_RS23790 (124495)	124495..124752	+	258	WP_230133887.1	CPBP family intramembrane metalloprotease	-
LQ120_RS23795 (124845)	124845..125102	+	258	WP_000557619.1	type II toxin-antitoxin system antitoxin PemI	-
LQ120_RS23800 (125035)	125035..125436	+	402	WP_001398199.1	type II toxin-antitoxin system toxin endoribonuclease PemK	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	oqxA / oqxB / catA1 / tet(B) / blaTEM-1B / sul2 / aph(3'')-Ib / aph(6)-Id / sitABCD	iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA	1..160357	160357

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-45)

Sequences

Toxin

Protein

• Length: 50 a.a.
• Molecular weight: 5542.67 Da
• Isoelectric Point: 8.7678

>T295980 WP_001312851.1 NZ_OW968112:120850-120999 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Nucleotide

• Length: 150 bp

>T295980 NZ_OW968112:120850-120999 [Escherichia coli]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGAGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA

Antitoxin

Nucleotide

• Length: 62 bp

>AT295980 NZ_OW968112:c120806-120745 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Toxin

• AlphaFold DB: A0A829C8K5

Antitoxin