Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4578029..4578631 | Replicon | chromosome |
Accession | NZ_OW968111 | ||
Organism | Escherichia coli isolate 602 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | LQ120_RS22130 | Protein ID | WP_000897305.1 |
Coordinates | 4578320..4578631 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | LQ120_RS22125 | Protein ID | WP_000356397.1 |
Coordinates | 4578029..4578319 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ120_RS22100 (4573955) | 4573955..4574857 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
LQ120_RS22105 (4574854) | 4574854..4575489 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
LQ120_RS22110 (4575486) | 4575486..4576415 | + | 930 | WP_001749031.1 | formate dehydrogenase accessory protein FdhE | - |
LQ120_RS22115 (4576745) | 4576745..4576987 | - | 243 | WP_001086388.1 | protein YiiF | - |
LQ120_RS22120 (4577206) | 4577206..4577424 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
LQ120_RS22125 (4578029) | 4578029..4578319 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
LQ120_RS22130 (4578320) | 4578320..4578631 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
LQ120_RS22135 (4578860) | 4578860..4579768 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
LQ120_RS22140 (4579832) | 4579832..4580773 | - | 942 | WP_001343389.1 | fatty acid biosynthesis protein FabY | - |
LQ120_RS22145 (4580818) | 4580818..4581255 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
LQ120_RS22150 (4581252) | 4581252..4582124 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
LQ120_RS22155 (4582118) | 4582118..4582717 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
LQ120_RS22160 (4582816) | 4582816..4583601 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T295978 WP_000897305.1 NZ_OW968111:c4578631-4578320 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|