Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 3154459..3155061 | Replicon | chromosome |
| Accession | NZ_OW968011 | ||
| Organism | Escherichia coli isolate 58 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | LQ149_RS15195 | Protein ID | WP_000897305.1 |
| Coordinates | 3154459..3154770 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | LQ149_RS15200 | Protein ID | WP_000356397.1 |
| Coordinates | 3154771..3155061 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ149_RS15165 (3149489) | 3149489..3150274 | + | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| LQ149_RS15170 (3150373) | 3150373..3150972 | + | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
| LQ149_RS15175 (3150966) | 3150966..3151838 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| LQ149_RS15180 (3151835) | 3151835..3152272 | + | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| LQ149_RS15185 (3152317) | 3152317..3153258 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| LQ149_RS15190 (3153322) | 3153322..3154230 | - | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
| LQ149_RS15195 (3154459) | 3154459..3154770 | + | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| LQ149_RS15200 (3154771) | 3154771..3155061 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| LQ149_RS15205 (3155666) | 3155666..3155884 | + | 219 | WP_001315930.1 | CopG family transcriptional regulator | - |
| LQ149_RS15210 (3156104) | 3156104..3156346 | + | 243 | WP_001087409.1 | protein YiiF | - |
| LQ149_RS15215 (3156676) | 3156676..3157605 | - | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
| LQ149_RS15220 (3157602) | 3157602..3158237 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| LQ149_RS15225 (3158234) | 3158234..3159136 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T295954 WP_000897305.1 NZ_OW968011:3154459-3154770 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|