Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 2341422..2342221 | Replicon | chromosome |
Accession | NZ_OW968011 | ||
Organism | Escherichia coli isolate 58 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | F4VJD3 |
Locus tag | LQ149_RS11230 | Protein ID | WP_000347266.1 |
Coordinates | 2341757..2342221 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | LQ149_RS11225 | Protein ID | WP_001307405.1 |
Coordinates | 2341422..2341757 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ149_RS11210 (2337207) | 2337207..2337977 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
LQ149_RS11215 (2337993) | 2337993..2339327 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
LQ149_RS11220 (2339702) | 2339702..2341273 | + | 1572 | WP_001273741.1 | galactarate dehydratase | - |
LQ149_RS11225 (2341422) | 2341422..2341757 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
LQ149_RS11230 (2341757) | 2341757..2342221 | + | 465 | WP_000347266.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
LQ149_RS11235 (2342276) | 2342276..2343085 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
LQ149_RS11240 (2343334) | 2343334..2344614 | + | 1281 | WP_000681921.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
LQ149_RS11245 (2344637) | 2344637..2345110 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
LQ149_RS11250 (2345121) | 2345121..2345900 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
LQ149_RS11255 (2345890) | 2345890..2346768 | + | 879 | WP_001315856.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
LQ149_RS11260 (2346786) | 2346786..2347220 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2330773..2342221 | 11448 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17841.18 Da Isoelectric Point: 9.4947
>T295951 WP_000347266.1 NZ_OW968011:2341757-2342221 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRFFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRFFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A836NGD2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |