Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 327655..327875 Replicon chromosome
Accession NZ_OW968011
Organism Escherichia coli isolate 58

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag LQ149_RS01635 Protein ID WP_000170965.1
Coordinates 327655..327762 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 327809..327875 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ149_RS01605 323510..324343 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
LQ149_RS01610 324340..324732 + 393 WP_000200392.1 invasion regulator SirB2 -
LQ149_RS01615 324736..325545 + 810 WP_001257044.1 invasion regulator SirB1 -
LQ149_RS01620 325581..326435 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
LQ149_RS01625 326584..326691 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 326739..326805 + 67 NuclAT_49 - -
- 326739..326805 + 67 NuclAT_49 - -
- 326739..326805 + 67 NuclAT_49 - -
- 326739..326805 + 67 NuclAT_49 - -
- 326739..326805 + 67 NuclAT_52 - -
- 326739..326805 + 67 NuclAT_52 - -
- 326739..326805 + 67 NuclAT_52 - -
- 326739..326805 + 67 NuclAT_52 - -
- 326739..326805 + 67 NuclAT_55 - -
- 326739..326805 + 67 NuclAT_55 - -
- 326739..326805 + 67 NuclAT_55 - -
- 326739..326805 + 67 NuclAT_55 - -
- 326741..326804 + 64 NuclAT_14 - -
- 326741..326804 + 64 NuclAT_14 - -
- 326741..326804 + 64 NuclAT_14 - -
- 326741..326804 + 64 NuclAT_14 - -
- 326741..326804 + 64 NuclAT_17 - -
- 326741..326804 + 64 NuclAT_17 - -
- 326741..326804 + 64 NuclAT_17 - -
- 326741..326804 + 64 NuclAT_17 - -
- 326741..326804 + 64 NuclAT_20 - -
- 326741..326804 + 64 NuclAT_20 - -
- 326741..326804 + 64 NuclAT_20 - -
- 326741..326804 + 64 NuclAT_20 - -
- 326741..326804 + 64 NuclAT_23 - -
- 326741..326804 + 64 NuclAT_23 - -
- 326741..326804 + 64 NuclAT_23 - -
- 326741..326804 + 64 NuclAT_23 - -
- 326741..326804 + 64 NuclAT_26 - -
- 326741..326804 + 64 NuclAT_26 - -
- 326741..326804 + 64 NuclAT_26 - -
- 326741..326804 + 64 NuclAT_26 - -
- 326741..326804 + 64 NuclAT_29 - -
- 326741..326804 + 64 NuclAT_29 - -
- 326741..326804 + 64 NuclAT_29 - -
- 326741..326804 + 64 NuclAT_29 - -
- 326741..326806 + 66 NuclAT_32 - -
- 326741..326806 + 66 NuclAT_32 - -
- 326741..326806 + 66 NuclAT_32 - -
- 326741..326806 + 66 NuclAT_32 - -
- 326741..326806 + 66 NuclAT_35 - -
- 326741..326806 + 66 NuclAT_35 - -
- 326741..326806 + 66 NuclAT_35 - -
- 326741..326806 + 66 NuclAT_35 - -
- 326741..326806 + 66 NuclAT_38 - -
- 326741..326806 + 66 NuclAT_38 - -
- 326741..326806 + 66 NuclAT_38 - -
- 326741..326806 + 66 NuclAT_38 - -
- 326741..326806 + 66 NuclAT_41 - -
- 326741..326806 + 66 NuclAT_41 - -
- 326741..326806 + 66 NuclAT_41 - -
- 326741..326806 + 66 NuclAT_41 - -
- 326741..326806 + 66 NuclAT_44 - -
- 326741..326806 + 66 NuclAT_44 - -
- 326741..326806 + 66 NuclAT_44 - -
- 326741..326806 + 66 NuclAT_44 - -
- 326741..326806 + 66 NuclAT_47 - -
- 326741..326806 + 66 NuclAT_47 - -
- 326741..326806 + 66 NuclAT_47 - -
- 326741..326806 + 66 NuclAT_47 - -
LQ149_RS01630 327119..327226 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 327279..327340 + 62 NuclAT_15 - -
- 327279..327340 + 62 NuclAT_15 - -
- 327279..327340 + 62 NuclAT_15 - -
- 327279..327340 + 62 NuclAT_15 - -
- 327279..327340 + 62 NuclAT_18 - -
- 327279..327340 + 62 NuclAT_18 - -
- 327279..327340 + 62 NuclAT_18 - -
- 327279..327340 + 62 NuclAT_18 - -
- 327279..327340 + 62 NuclAT_21 - -
- 327279..327340 + 62 NuclAT_21 - -
- 327279..327340 + 62 NuclAT_21 - -
- 327279..327340 + 62 NuclAT_21 - -
- 327279..327340 + 62 NuclAT_24 - -
- 327279..327340 + 62 NuclAT_24 - -
- 327279..327340 + 62 NuclAT_24 - -
- 327279..327340 + 62 NuclAT_24 - -
- 327279..327340 + 62 NuclAT_27 - -
- 327279..327340 + 62 NuclAT_27 - -
- 327279..327340 + 62 NuclAT_27 - -
- 327279..327340 + 62 NuclAT_27 - -
- 327279..327340 + 62 NuclAT_30 - -
- 327279..327340 + 62 NuclAT_30 - -
- 327279..327340 + 62 NuclAT_30 - -
- 327279..327340 + 62 NuclAT_30 - -
- 327279..327341 + 63 NuclAT_50 - -
- 327279..327341 + 63 NuclAT_50 - -
- 327279..327341 + 63 NuclAT_50 - -
- 327279..327341 + 63 NuclAT_50 - -
- 327279..327341 + 63 NuclAT_53 - -
- 327279..327341 + 63 NuclAT_53 - -
- 327279..327341 + 63 NuclAT_53 - -
- 327279..327341 + 63 NuclAT_53 - -
- 327279..327341 + 63 NuclAT_56 - -
- 327279..327341 + 63 NuclAT_56 - -
- 327279..327341 + 63 NuclAT_56 - -
- 327279..327341 + 63 NuclAT_56 - -
- 327279..327342 + 64 NuclAT_33 - -
- 327279..327342 + 64 NuclAT_33 - -
- 327279..327342 + 64 NuclAT_33 - -
- 327279..327342 + 64 NuclAT_33 - -
- 327279..327342 + 64 NuclAT_36 - -
- 327279..327342 + 64 NuclAT_36 - -
- 327279..327342 + 64 NuclAT_36 - -
- 327279..327342 + 64 NuclAT_36 - -
- 327279..327342 + 64 NuclAT_39 - -
- 327279..327342 + 64 NuclAT_39 - -
- 327279..327342 + 64 NuclAT_39 - -
- 327279..327342 + 64 NuclAT_39 - -
- 327279..327342 + 64 NuclAT_42 - -
- 327279..327342 + 64 NuclAT_42 - -
- 327279..327342 + 64 NuclAT_42 - -
- 327279..327342 + 64 NuclAT_42 - -
- 327279..327342 + 64 NuclAT_45 - -
- 327279..327342 + 64 NuclAT_45 - -
- 327279..327342 + 64 NuclAT_45 - -
- 327279..327342 + 64 NuclAT_45 - -
- 327279..327342 + 64 NuclAT_48 - -
- 327279..327342 + 64 NuclAT_48 - -
- 327279..327342 + 64 NuclAT_48 - -
- 327279..327342 + 64 NuclAT_48 - -
LQ149_RS01635 327655..327762 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 327809..327875 + 67 - - Antitoxin
LQ149_RS01640 328167..329267 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
LQ149_RS01645 329537..329767 + 231 WP_001146442.1 putative cation transport regulator ChaB -
LQ149_RS01650 329925..330620 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
LQ149_RS01655 330664..331017 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
LQ149_RS01660 331202..332596 + 1395 WP_000086201.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T295939 WP_000170965.1 NZ_OW968011:c327762-327655 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT295939 NZ_OW968011:327809-327875 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References