Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 69395..69649 | Replicon | plasmid P1 |
| Accession | NZ_OW967976 | ||
| Organism | Escherichia coli isolate 10 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | LQ150_RS23960 | Protein ID | WP_001312851.1 |
| Coordinates | 69395..69544 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 69588..69649 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ150_RS23925 (64637) | 64637..65494 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| LQ150_RS23930 (65487) | 65487..65969 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| LQ150_RS23935 (65962) | 65962..66009 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| LQ150_RS23940 (66000) | 66000..66263 | + | 264 | WP_230163686.1 | replication protein RepA | - |
| LQ150_RS23945 (66334) | 66334..67080 | - | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| LQ150_RS23950 (67095) | 67095..68636 | - | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| LQ150_RS23955 (68854) | 68854..69111 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| LQ150_RS23960 (69395) | 69395..69544 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (69588) | 69588..69649 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (69588) | 69588..69649 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (69588) | 69588..69649 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (69588) | 69588..69649 | + | 62 | NuclAT_1 | - | Antitoxin |
| LQ150_RS23965 (69905) | 69905..69979 | - | 75 | Protein_72 | endonuclease | - |
| LQ150_RS23970 (70225) | 70225..70437 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| LQ150_RS23975 (70573) | 70573..71133 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| LQ150_RS23980 (71236) | 71236..72096 | - | 861 | WP_025693494.1 | alpha/beta hydrolase | - |
| LQ150_RS23985 (72155) | 72155..72901 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | sitABCD | iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA | 1..106879 | 106879 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T295920 WP_001312851.1 NZ_OW967976:c69544-69395 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT295920 NZ_OW967976:69588-69649 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|