Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3753222..3753916 | Replicon | chromosome |
Accession | NZ_OW967975 | ||
Organism | Escherichia coli isolate 10 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | LQ150_RS18260 | Protein ID | WP_001263489.1 |
Coordinates | 3753222..3753620 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | LQ150_RS18265 | Protein ID | WP_000554758.1 |
Coordinates | 3753623..3753916 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (3748810) | 3748810..3748890 | - | 81 | NuclAT_11 | - | - |
- (3748810) | 3748810..3748890 | - | 81 | NuclAT_11 | - | - |
- (3748810) | 3748810..3748890 | - | 81 | NuclAT_11 | - | - |
- (3748810) | 3748810..3748890 | - | 81 | NuclAT_11 | - | - |
LQ150_RS18235 (3749486) | 3749486..3749944 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
LQ150_RS18240 (3750205) | 3750205..3751662 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
LQ150_RS18245 (3751719) | 3751719..3752240 | - | 522 | Protein_3589 | peptide chain release factor H | - |
LQ150_RS18250 (3752236) | 3752236..3752442 | - | 207 | Protein_3590 | RtcB family protein | - |
LQ150_RS18255 (3752760) | 3752760..3753212 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
LQ150_RS18260 (3753222) | 3753222..3753620 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
LQ150_RS18265 (3753623) | 3753623..3753916 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
LQ150_RS18270 (3753968) | 3753968..3755023 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
LQ150_RS18275 (3755094) | 3755094..3755879 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
LQ150_RS18280 (3755851) | 3755851..3757563 | + | 1713 | Protein_3596 | flagellar biosynthesis protein FlhA | - |
LQ150_RS18285 (3757787) | 3757787..3758284 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | gmhA/lpcA | 3753222..3768502 | 15280 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T295915 WP_001263489.1 NZ_OW967975:c3753620-3753222 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |