Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4880215..4880817 | Replicon | chromosome |
| Accession | NZ_OW967966 | ||
| Organism | Escherichia coli isolate 648 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | LQ127_RS23850 | Protein ID | WP_000897305.1 |
| Coordinates | 4880506..4880817 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | LQ127_RS23845 | Protein ID | WP_000356397.1 |
| Coordinates | 4880215..4880505 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ127_RS23825 (4876717) | 4876717..4877619 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| LQ127_RS23830 (4877616) | 4877616..4878251 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| LQ127_RS23835 (4878248) | 4878248..4879177 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
| LQ127_RS23840 (4879392) | 4879392..4879610 | - | 219 | WP_001298592.1 | CopG family transcriptional regulator | - |
| LQ127_RS23845 (4880215) | 4880215..4880505 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| LQ127_RS23850 (4880506) | 4880506..4880817 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| LQ127_RS23855 (4881046) | 4881046..4881954 | + | 909 | WP_001318161.1 | alpha/beta hydrolase | - |
| LQ127_RS23860 (4882018) | 4882018..4882959 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| LQ127_RS23865 (4883004) | 4883004..4883441 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| LQ127_RS23870 (4883438) | 4883438..4884310 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| LQ127_RS23875 (4884304) | 4884304..4884903 | - | 600 | WP_001314324.1 | glucose-1-phosphatase | - |
| LQ127_RS23880 (4885002) | 4885002..4885787 | - | 786 | WP_000059679.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T295898 WP_000897305.1 NZ_OW967966:c4880817-4880506 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|