Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 4003333..4004027 | Replicon | chromosome |
| Accession | NZ_OW967966 | ||
| Organism | Escherichia coli isolate 648 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q0T7Q5 |
| Locus tag | LQ127_RS19630 | Protein ID | WP_001263491.1 |
| Coordinates | 4003333..4003731 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | L4JHF0 |
| Locus tag | LQ127_RS19635 | Protein ID | WP_000554755.1 |
| Coordinates | 4003734..4004027 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (3999227) | 3999227..3999307 | - | 81 | NuclAT_10 | - | - |
| - (3999227) | 3999227..3999307 | - | 81 | NuclAT_10 | - | - |
| - (3999227) | 3999227..3999307 | - | 81 | NuclAT_10 | - | - |
| - (3999227) | 3999227..3999307 | - | 81 | NuclAT_10 | - | - |
| LQ127_RS19605 (3998567) | 3998567..3999811 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
| LQ127_RS19610 (3999903) | 3999903..4000361 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| LQ127_RS19615 (4000622) | 4000622..4002079 | + | 1458 | WP_022645227.1 | cytosol nonspecific dipeptidase | - |
| LQ127_RS19620 (4002326) | 4002326..4003023 | + | 698 | WP_223216367.1 | IS1 family transposase | - |
| LQ127_RS19625 (4003039) | 4003039..4003323 | - | 285 | Protein_3862 | GNAT family N-acetyltransferase | - |
| LQ127_RS19630 (4003333) | 4003333..4003731 | - | 399 | WP_001263491.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| LQ127_RS19635 (4003734) | 4003734..4004027 | - | 294 | WP_000554755.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| LQ127_RS19640 (4004079) | 4004079..4005134 | - | 1056 | WP_022645222.1 | DNA polymerase IV | - |
| LQ127_RS19645 (4005205) | 4005205..4005990 | - | 786 | WP_072224360.1 | putative lateral flagellar export/assembly protein LafU | - |
| LQ127_RS19650 (4005962) | 4005962..4007674 | + | 1713 | Protein_3867 | flagellar biosynthesis protein FlhA | - |
| LQ127_RS19655 (4007772) | 4007772..4008545 | - | 774 | WP_022645219.1 | C40 family peptidase | - |
| LQ127_RS19660 (4008731) | 4008731..4008991 | + | 261 | WP_000729708.1 | type II toxin-antitoxin system antitoxin DinJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3983011..4008545 | 25534 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15457.86 Da Isoelectric Point: 8.0949
>T295893 WP_001263491.1 NZ_OW967966:c4003731-4003333 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TPK7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829G9H5 |