Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 4003333..4004027 Replicon chromosome
Accession NZ_OW967966
Organism Escherichia coli isolate 648

Toxin (Protein)


Gene name yafO Uniprot ID Q0T7Q5
Locus tag LQ127_RS19630 Protein ID WP_001263491.1
Coordinates 4003333..4003731 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag LQ127_RS19635 Protein ID WP_000554755.1
Coordinates 4003734..4004027 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (3999227) 3999227..3999307 - 81 NuclAT_10 - -
- (3999227) 3999227..3999307 - 81 NuclAT_10 - -
- (3999227) 3999227..3999307 - 81 NuclAT_10 - -
- (3999227) 3999227..3999307 - 81 NuclAT_10 - -
LQ127_RS19605 (3998567) 3998567..3999811 - 1245 WP_000189541.1 esterase FrsA -
LQ127_RS19610 (3999903) 3999903..4000361 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
LQ127_RS19615 (4000622) 4000622..4002079 + 1458 WP_022645227.1 cytosol nonspecific dipeptidase -
LQ127_RS19620 (4002326) 4002326..4003023 + 698 WP_223216367.1 IS1 family transposase -
LQ127_RS19625 (4003039) 4003039..4003323 - 285 Protein_3862 GNAT family N-acetyltransferase -
LQ127_RS19630 (4003333) 4003333..4003731 - 399 WP_001263491.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
LQ127_RS19635 (4003734) 4003734..4004027 - 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
LQ127_RS19640 (4004079) 4004079..4005134 - 1056 WP_022645222.1 DNA polymerase IV -
LQ127_RS19645 (4005205) 4005205..4005990 - 786 WP_072224360.1 putative lateral flagellar export/assembly protein LafU -
LQ127_RS19650 (4005962) 4005962..4007674 + 1713 Protein_3867 flagellar biosynthesis protein FlhA -
LQ127_RS19655 (4007772) 4007772..4008545 - 774 WP_022645219.1 C40 family peptidase -
LQ127_RS19660 (4008731) 4008731..4008991 + 261 WP_000729708.1 type II toxin-antitoxin system antitoxin DinJ -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3983011..4008545 25534


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15457.86 Da        Isoelectric Point: 8.0949

>T295893 WP_001263491.1 NZ_OW967966:c4003731-4003333 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT295893 WP_000554755.1 NZ_OW967966:c4004027-4003734 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TPK7

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References