Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 833291..833984 | Replicon | chromosome |
Accession | NZ_OW967966 | ||
Organism | Escherichia coli isolate 648 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | LQ127_RS03980 | Protein ID | WP_000415584.1 |
Coordinates | 833291..833587 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | LQ127_RS03985 | Protein ID | WP_000650107.1 |
Coordinates | 833589..833984 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ127_RS03945 (828379) | 828379..828693 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
LQ127_RS03950 (828724) | 828724..829305 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
LQ127_RS03955 (829624) | 829624..829956 | + | 333 | WP_023149630.1 | DUF2645 family protein | - |
LQ127_RS03960 (830002) | 830002..831351 | - | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
LQ127_RS03965 (831348) | 831348..832007 | - | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
LQ127_RS03970 (832159) | 832159..832551 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
LQ127_RS03975 (832604) | 832604..833086 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
LQ127_RS03980 (833291) | 833291..833587 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
LQ127_RS03985 (833589) | 833589..833984 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
LQ127_RS03990 (834117) | 834117..835724 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
LQ127_RS03995 (835862) | 835862..838120 | + | 2259 | WP_025693397.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T295878 WP_000415584.1 NZ_OW967966:833291-833587 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT295878 WP_000650107.1 NZ_OW967966:833589-833984 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|