Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 69297..69536 | Replicon | plasmid P1 |
| Accession | NZ_OW967803 | ||
| Organism | Escherichia coli isolate 410 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | LQ147_RS23255 | Protein ID | WP_023144756.1 |
| Coordinates | 69297..69431 (-) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 69476..69536 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ147_RS23225 (65578) | 65578..65871 | + | 294 | WP_116961751.1 | WbuC family cupin fold metalloprotein | - |
| LQ147_RS23230 (65918) | 65918..66793 | - | 876 | WP_000239590.1 | extended-spectrum class A beta-lactamase CTX-M-15 | - |
| LQ147_RS23235 (67049) | 67049..67120 | - | 72 | Protein_82 | hypothetical protein | - |
| LQ147_RS23240 (67175) | 67175..67879 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| LQ147_RS23245 (67945) | 67945..68586 | + | 642 | Protein_84 | IS21-like element ISEc12 family helper ATPase IstB | - |
| LQ147_RS23250 (68746) | 68746..69000 | - | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
| LQ147_RS23255 (69297) | 69297..69431 | - | 135 | WP_023144756.1 | Hok/Gef family protein | Toxin |
| - (69476) | 69476..69536 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (69476) | 69476..69536 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (69476) | 69476..69536 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (69476) | 69476..69536 | + | 61 | NuclAT_0 | - | Antitoxin |
| LQ147_RS23260 (69503) | 69503..69789 | - | 287 | Protein_87 | DUF2726 domain-containing protein | - |
| LQ147_RS23265 (70302) | 70302..70514 | - | 213 | WP_013023861.1 | hypothetical protein | - |
| LQ147_RS23270 (70645) | 70645..71205 | - | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
| LQ147_RS23275 (71260) | 71260..72006 | - | 747 | WP_000205718.1 | conjugal transfer pilus acetylase TraX | - |
| LQ147_RS23280 (72026) | 72026..74419 | - | 2394 | Protein_91 | conjugative transfer relaxase/helicase TraI | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | tet(B) / sul1 / qacE / aadA2 / dfrA12 / blaNDM-5 / aadA5 / blaTEM-1B / aac(3)-IId / mph(A) / aph(6)-Id / aph(3'')-Ib / sul2 / aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 | - | 1..109109 | 109109 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T295869 WP_023144756.1 NZ_OW967803:c69431-69297 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
Antitoxin
Download Length: 61 bp
>AT295869 NZ_OW967803:69476-69536 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
