Detailed information of TA system TA295847

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 122626..123047
• Replicon: plasmid P1
• Accession: NZ_OW967796
• Organism: Escherichia coli isolate 538

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: LQ148_RS23455
• Protein ID: WP_096937776.1
• Coordinates: 122626..122751 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	122849..123047 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
LQ148_RS23415 (117691)	117691..117906	-	216	WP_000086381.1	conjugal transfer relaxosome protein TraY	-
LQ148_RS23420 (118042)	118042..118689	-	648	WP_000332519.1	conjugal transfer transcriptional regulator TraJ	-
LQ148_RS23425 (118880)	118880..119263	-	384	WP_001063021.1	conjugal transfer relaxosome DNA-binding protein TraM	-
LQ148_RS23430 (119603)	119603..120205	+	603	WP_077543385.1	transglycosylase SLT domain-containing protein	-
LQ148_RS23435 (120501)	120501..121322	-	822	WP_001234475.1	DUF932 domain-containing protein	-
LQ148_RS23440 (121441)	121441..121728	-	288	WP_000107542.1	hypothetical protein	-
LQ148_RS23445 (121792)	121792..121959	-	168	WP_077543387.1	single-stranded DNA-binding protein	-
LQ148_RS23450 (122029)	122029..122325	+	297	Protein_119	hypothetical protein	-
LQ148_RS23455 (122626)	122626..122751	-	126	WP_096937776.1	type I toxin-antitoxin system Hok family toxin	Toxin
LQ148_RS23460 (122693)	122693..122842	-	150	Protein_121	DUF5431 family protein	-
- (122849)	122849..123047	-	199	NuclAT_0	-	Antitoxin
- (122849)	122849..123047	-	199	NuclAT_0	-	Antitoxin
- (122849)	122849..123047	-	199	NuclAT_0	-	Antitoxin
- (122849)	122849..123047	-	199	NuclAT_0	-	Antitoxin
LQ148_RS23465 (123016)	123016..123778	-	763	Protein_122	plasmid SOS inhibition protein A	-
LQ148_RS23470 (123775)	123775..124209	-	435	WP_000845928.1	conjugation system SOS inhibitor PsiB	-
LQ148_RS23475 (124264)	124264..126222	-	1959	WP_021516762.1	ParB/RepB/Spo0J family partition protein	-
LQ148_RS23480 (126288)	126288..126521	-	234	WP_000005990.1	DUF905 family protein	-
LQ148_RS23485 (126578)	126578..127030	-	453	WP_000290802.1	single-stranded DNA-binding protein	-
LQ148_RS23490 (127332)	127332..127833	+	502	Protein_127	hypothetical protein	-
LQ148_RS23495 (127812)	127812..128003	-	192	WP_001027500.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	papH / papC / hlyB / iroB / iroC / iroD / iroE / iroN / papC / papH	1..148717	148717

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4806.72 Da
• Isoelectric Point: 8.4890

>T295847 WP_096937776.1 NZ_OW967796:c122751-122626 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 199 bp

>AT295847 NZ_OW967796:c123047-122849 [Escherichia coli]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC

Structures

Antitoxin