Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 86021..86275 | Replicon | plasmid P1 |
| Accession | NZ_OW967796 | ||
| Organism | Escherichia coli isolate 538 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | LQ148_RS23245 | Protein ID | WP_001312851.1 |
| Coordinates | 86021..86170 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 86214..86275 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ148_RS23205 (81801) | 81801..82346 | - | 546 | WP_001523466.1 | hypothetical protein | - |
| LQ148_RS23210 (82356) | 82356..82643 | - | 288 | WP_001523468.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| LQ148_RS23215 (82640) | 82640..82891 | - | 252 | WP_001139206.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| LQ148_RS23220 (82978) | 82978..83145 | - | 168 | WP_032146603.1 | hypothetical protein | - |
| LQ148_RS23225 (83847) | 83847..84704 | - | 858 | WP_001523472.1 | incFII family plasmid replication initiator RepA | - |
| LQ148_RS23230 (84697) | 84697..85179 | - | 483 | WP_001523473.1 | hypothetical protein | - |
| LQ148_RS23235 (85172) | 85172..85246 | - | 75 | WP_001442103.1 | RepA leader peptide Tap | - |
| LQ148_RS23240 (85480) | 85480..85737 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| LQ148_RS23245 (86021) | 86021..86170 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (86214) | 86214..86275 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (86214) | 86214..86275 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (86214) | 86214..86275 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (86214) | 86214..86275 | + | 62 | NuclAT_1 | - | Antitoxin |
| LQ148_RS23250 (86858) | 86858..87070 | - | 213 | WP_032084501.1 | hypothetical protein | - |
| LQ148_RS23255 (87203) | 87203..87763 | - | 561 | WP_001523482.1 | fertility inhibition protein FinO | - |
| LQ148_RS23260 (87818) | 87818..88564 | - | 747 | WP_001523483.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | papH / papC / hlyB / iroB / iroC / iroD / iroE / iroN / papC / papH | 1..148717 | 148717 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T295845 WP_001312851.1 NZ_OW967796:c86170-86021 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT295845 NZ_OW967796:86214-86275 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
