Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4526897..4527499 | Replicon | chromosome |
Accession | NZ_OW967795 | ||
Organism | Escherichia coli isolate 538 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A3L4YH82 |
Locus tag | LQ148_RS21810 | Protein ID | WP_000897303.1 |
Coordinates | 4527188..4527499 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | LQ148_RS21805 | Protein ID | WP_000356397.1 |
Coordinates | 4526897..4527187 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ148_RS21775 (4522202) | 4522202..4523131 | + | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
LQ148_RS21780 (4523313) | 4523313..4523555 | - | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
LQ148_RS21785 (4523845) | 4523845..4524693 | + | 849 | WP_001038651.1 | hypothetical protein | - |
LQ148_RS21790 (4524718) | 4524718..4525458 | + | 741 | WP_022296249.1 | hypothetical protein | - |
LQ148_RS21795 (4525643) | 4525643..4525861 | - | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
LQ148_RS21800 (4526260) | 4526260..4526538 | - | 279 | WP_001296612.1 | hypothetical protein | - |
LQ148_RS21805 (4526897) | 4526897..4527187 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
LQ148_RS21810 (4527188) | 4527188..4527499 | - | 312 | WP_000897303.1 | hypothetical protein | Toxin |
LQ148_RS21815 (4527728) | 4527728..4528636 | + | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
LQ148_RS21820 (4528700) | 4528700..4529641 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
LQ148_RS21825 (4529686) | 4529686..4530123 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
LQ148_RS21830 (4530120) | 4530120..4530992 | - | 873 | WP_000920763.1 | virulence factor BrkB family protein | - |
LQ148_RS21835 (4530986) | 4530986..4531585 | - | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12302.33 Da Isoelectric Point: 10.0233
>T295843 WP_000897303.1 NZ_OW967795:c4527499-4527188 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGRLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGRLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|