Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) symER/SymE(toxin)
Location 3974173..3974582 Replicon chromosome
Accession NZ_OW967795
Organism Escherichia coli isolate 538

Toxin (Protein)


Gene name symE Uniprot ID A0A3L4RJH9
Locus tag LQ148_RS19315 Protein ID WP_001357525.1
Coordinates 3974244..3974582 (+) Length 113 a.a.

Antitoxin (RNA)


Gene name symR
Locus tag -
Coordinates 3974173..3974249 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ148_RS19295 (3970240) 3970240..3970443 + 204 WP_000467859.1 YbdD/YjiX family protein -
LQ148_RS19300 (3970454) 3970454..3971410 + 957 WP_022296912.1 GTPase -
LQ148_RS19305 (3971741) 3971741..3973591 + 1851 WP_000190966.1 nuclease-related domain-containing DEAD/DEAH box helicase -
LQ148_RS19310 (3973820) 3973820..3974029 + 210 Protein_3783 DUF3387 domain-containing protein -
- (3974173) 3974173..3974249 - 77 NuclAT_12 - Antitoxin
- (3974173) 3974173..3974249 - 77 NuclAT_12 - Antitoxin
- (3974173) 3974173..3974249 - 77 NuclAT_12 - Antitoxin
- (3974173) 3974173..3974249 - 77 NuclAT_12 - Antitoxin
- (3974173) 3974173..3974249 - 77 NuclAT_13 - Antitoxin
- (3974173) 3974173..3974249 - 77 NuclAT_13 - Antitoxin
- (3974173) 3974173..3974249 - 77 NuclAT_13 - Antitoxin
- (3974173) 3974173..3974249 - 77 NuclAT_13 - Antitoxin
LQ148_RS19315 (3974244) 3974244..3974582 + 339 WP_001357525.1 endoribonuclease SymE Toxin
LQ148_RS19320 (3974670) 3974670..3974804 - 135 WP_230158887.1 hypothetical protein -
LQ148_RS19325 (3974966) 3974966..3975280 + 315 Protein_3786 winged helix-turn-helix domain-containing protein -
LQ148_RS19330 (3975272) 3975272..3976192 - 921 WP_022296911.1 Rpn family recombination-promoting nuclease/putative transposase -
LQ148_RS19335 (3976377) 3976377..3977657 + 1281 WP_001523887.1 DUF445 domain-containing protein -
LQ148_RS19340 (3977775) 3977775..3978926 + 1152 WP_001298064.1 double-cubane-cluster-containing anaerobic reductase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin SymE-like

(20-71)


Sequences

Toxin        


Download         Length: 113 a.a.        Molecular weight: 12314.03 Da        Isoelectric Point: 7.8234

>T295841 WP_001357525.1 NZ_OW967795:3974244-3974582 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFTTGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQRQVQDFIGVISSKTPR

Download         Length: 339 bp

Antitoxin


Download         Length: 77 bp

>AT295841 NZ_OW967795:c3974249-3974173 [Escherichia coli]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3L4RJH9

Antitoxin

Download structure file

References