Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | symER/SymE(toxin) |
| Location | 3974173..3974582 | Replicon | chromosome |
| Accession | NZ_OW967795 | ||
| Organism | Escherichia coli isolate 538 | ||
Toxin (Protein)
| Gene name | symE | Uniprot ID | A0A3L4RJH9 |
| Locus tag | LQ148_RS19315 | Protein ID | WP_001357525.1 |
| Coordinates | 3974244..3974582 (+) | Length | 113 a.a. |
Antitoxin (RNA)
| Gene name | symR | ||
| Locus tag | - | ||
| Coordinates | 3974173..3974249 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ148_RS19295 (3970240) | 3970240..3970443 | + | 204 | WP_000467859.1 | YbdD/YjiX family protein | - |
| LQ148_RS19300 (3970454) | 3970454..3971410 | + | 957 | WP_022296912.1 | GTPase | - |
| LQ148_RS19305 (3971741) | 3971741..3973591 | + | 1851 | WP_000190966.1 | nuclease-related domain-containing DEAD/DEAH box helicase | - |
| LQ148_RS19310 (3973820) | 3973820..3974029 | + | 210 | Protein_3783 | DUF3387 domain-containing protein | - |
| - (3974173) | 3974173..3974249 | - | 77 | NuclAT_12 | - | Antitoxin |
| - (3974173) | 3974173..3974249 | - | 77 | NuclAT_12 | - | Antitoxin |
| - (3974173) | 3974173..3974249 | - | 77 | NuclAT_12 | - | Antitoxin |
| - (3974173) | 3974173..3974249 | - | 77 | NuclAT_12 | - | Antitoxin |
| - (3974173) | 3974173..3974249 | - | 77 | NuclAT_13 | - | Antitoxin |
| - (3974173) | 3974173..3974249 | - | 77 | NuclAT_13 | - | Antitoxin |
| - (3974173) | 3974173..3974249 | - | 77 | NuclAT_13 | - | Antitoxin |
| - (3974173) | 3974173..3974249 | - | 77 | NuclAT_13 | - | Antitoxin |
| LQ148_RS19315 (3974244) | 3974244..3974582 | + | 339 | WP_001357525.1 | endoribonuclease SymE | Toxin |
| LQ148_RS19320 (3974670) | 3974670..3974804 | - | 135 | WP_230158887.1 | hypothetical protein | - |
| LQ148_RS19325 (3974966) | 3974966..3975280 | + | 315 | Protein_3786 | winged helix-turn-helix domain-containing protein | - |
| LQ148_RS19330 (3975272) | 3975272..3976192 | - | 921 | WP_022296911.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
| LQ148_RS19335 (3976377) | 3976377..3977657 | + | 1281 | WP_001523887.1 | DUF445 domain-containing protein | - |
| LQ148_RS19340 (3977775) | 3977775..3978926 | + | 1152 | WP_001298064.1 | double-cubane-cluster-containing anaerobic reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 12314.03 Da Isoelectric Point: 7.8234
>T295841 WP_001357525.1 NZ_OW967795:3974244-3974582 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFTTGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQRQVQDFIGVISSKTPR
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFTTGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQRQVQDFIGVISSKTPR
Download Length: 339 bp
Antitoxin
Download Length: 77 bp
>AT295841 NZ_OW967795:c3974249-3974173 [Escherichia coli]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|