Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3572264..3572958 | Replicon | chromosome |
| Accession | NZ_OW967795 | ||
| Organism | Escherichia coli isolate 538 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1PJQ2 |
| Locus tag | LQ148_RS17330 | Protein ID | WP_001263500.1 |
| Coordinates | 3572264..3572662 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | LQ148_RS17335 | Protein ID | WP_000554758.1 |
| Coordinates | 3572665..3572958 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ148_RS17305 (3567630) | 3567630..3568088 | - | 459 | WP_001291991.1 | xanthine phosphoribosyltransferase | - |
| LQ148_RS17310 (3568349) | 3568349..3569806 | + | 1458 | WP_001293022.1 | cytosol nonspecific dipeptidase | - |
| LQ148_RS17315 (3569862) | 3569862..3570476 | - | 615 | WP_000602123.1 | peptide chain release factor H | - |
| LQ148_RS17320 (3570473) | 3570473..3571612 | - | 1140 | WP_022296578.1 | RNA ligase RtcB family protein | - |
| LQ148_RS17325 (3571802) | 3571802..3572254 | - | 453 | WP_071589393.1 | GNAT family N-acetyltransferase | - |
| LQ148_RS17330 (3572264) | 3572264..3572662 | - | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| LQ148_RS17335 (3572665) | 3572665..3572958 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| LQ148_RS17340 (3573010) | 3573010..3574065 | - | 1056 | WP_001226168.1 | DNA polymerase IV | - |
| LQ148_RS17345 (3574136) | 3574136..3574921 | - | 786 | WP_000207551.1 | putative lateral flagellar export/assembly protein LafU | - |
| LQ148_RS17350 (3574893) | 3574893..3576605 | + | 1713 | Protein_3400 | flagellar biosynthesis protein FlhA | - |
| LQ148_RS17355 (3576721) | 3576721..3577218 | - | 498 | WP_000006239.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | gtrB | 3519720..3578143 | 58423 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T295839 WP_001263500.1 NZ_OW967795:c3572662-3572264 [Escherichia coli]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|