Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 3312800..3313479 | Replicon | chromosome |
Accession | NZ_OW967795 | ||
Organism | Escherichia coli isolate 538 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1PK60 |
Locus tag | LQ148_RS16030 | Protein ID | WP_000057523.1 |
Coordinates | 3313177..3313479 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | LQ148_RS16025 | Protein ID | WP_000806442.1 |
Coordinates | 3312800..3313141 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ148_RS16015 (3309044) | 3309044..3309976 | - | 933 | WP_000883041.1 | glutaminase A | - |
LQ148_RS16020 (3310238) | 3310238..3312742 | + | 2505 | WP_225387190.1 | copper-exporting P-type ATPase CopA | - |
LQ148_RS16025 (3312800) | 3312800..3313141 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
LQ148_RS16030 (3313177) | 3313177..3313479 | - | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LQ148_RS16035 (3313612) | 3313612..3314406 | + | 795 | WP_022296631.1 | TraB/GumN family protein | - |
LQ148_RS16040 (3314610) | 3314610..3315089 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
LQ148_RS16045 (3315126) | 3315126..3316778 | - | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
LQ148_RS16050 (3316996) | 3316996..3318216 | + | 1221 | WP_022296630.1 | fosmidomycin MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T295837 WP_000057523.1 NZ_OW967795:c3313479-3313177 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|