Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 182574..182796 Replicon chromosome
Accession NZ_OW967795
Organism Escherichia coli isolate 538

Toxin (Protein)


Gene name ldrD Uniprot ID S1NWX0
Locus tag LQ148_RS00855 Protein ID WP_001295224.1
Coordinates 182689..182796 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 182574..182632 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ148_RS00835 178015..178917 + 903 WP_000084677.1 dipeptide ABC transporter permease DppC -
LQ148_RS00840 178928..179911 + 984 WP_001196477.1 dipeptide ABC transporter ATP-binding protein -
LQ148_RS00845 179908..180912 + 1005 WP_000103571.1 dipeptide ABC transporter ATP-binding subunit DppF -
LQ148_RS00850 180942..182213 - 1272 WP_001296513.1 aromatic amino acid transport family protein -
- 182574..182632 - 59 - - Antitoxin
LQ148_RS00855 182689..182796 + 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
LQ148_RS00860 183172..183279 + 108 WP_000170748.1 type I toxin-antitoxin system toxin Ldr family protein -
LQ148_RS00865 183655..183762 + 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
LQ148_RS00870 183848..185527 - 1680 WP_022296260.1 cellulose biosynthesis protein BcsG -
LQ148_RS00875 185524..185715 - 192 WP_000988308.1 cellulose biosynthesis protein BcsF -
LQ148_RS00880 185712..187283 - 1572 WP_001204941.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
LQ148_RS00885 187556..187744 + 189 WP_001063314.1 cellulose biosynthesis protein BcsR -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3882.70 Da        Isoelectric Point: 9.0157

>T295823 WP_001295224.1 NZ_OW967795:182689-182796 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Download         Length: 108 bp

Antitoxin


Download         Length: 59 bp

>AT295823 NZ_OW967795:c182632-182574 [Escherichia coli]
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TSJ7

Antitoxin

Download structure file

References