Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 365931..366597 | Replicon | chromosome |
Accession | NZ_OW967263 | ||
Organism | Citrobacter freundii isolate 22 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A8B5Q945 |
Locus tag | LQ176_RS01700 | Protein ID | WP_003847996.1 |
Coordinates | 366280..366597 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A4U6IRD5 |
Locus tag | LQ176_RS01695 | Protein ID | WP_003837894.1 |
Coordinates | 365931..366227 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ176_RS01680 (363107) | 363107..363580 | - | 474 | WP_003023524.1 | transcription elongation factor GreB | - |
LQ176_RS01685 (363806) | 363806..364525 | + | 720 | WP_001157751.1 | two-component system response regulator OmpR | - |
LQ176_RS01690 (364522) | 364522..365874 | + | 1353 | WP_003837891.1 | two-component system sensor histidine kinase EnvZ | - |
LQ176_RS01695 (365931) | 365931..366227 | - | 297 | WP_003837894.1 | NadS family protein | Antitoxin |
LQ176_RS01700 (366280) | 366280..366597 | - | 318 | WP_003847996.1 | hypothetical protein | Toxin |
LQ176_RS01705 (366720) | 366720..368342 | - | 1623 | WP_044701411.1 | phosphoenolpyruvate carboxykinase (ATP) | - |
LQ176_RS01710 (368721) | 368721..370439 | + | 1719 | WP_047715944.1 | DUF4153 domain-containing protein | - |
LQ176_RS01715 (370549) | 370549..371427 | - | 879 | WP_003023531.1 | Hsp33 family molecular chaperone HslO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12225.15 Da Isoelectric Point: 10.0909
>T295775 WP_003847996.1 NZ_OW967263:c366597-366280 [Citrobacter freundii]
MFTFIELQGFSKRRPLLLPDDEFRAFQEALIENPEAGDTIAGTGGFRKIRWSRSGMGKRSGIRVIYYNVTRKGRIYLALL
YPKNEQDDLTEEQKRVLMHLSNMLI
MFTFIELQGFSKRRPLLLPDDEFRAFQEALIENPEAGDTIAGTGGFRKIRWSRSGMGKRSGIRVIYYNVTRKGRIYLALL
YPKNEQDDLTEEQKRVLMHLSNMLI
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A8B5Q945 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4U6IRD5 |