Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4659298..4659900 | Replicon | chromosome |
Accession | NZ_OW967178 | ||
Organism | Escherichia coli isolate 362 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | LQ124_RS22115 | Protein ID | WP_000897305.1 |
Coordinates | 4659589..4659900 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | LQ124_RS22110 | Protein ID | WP_000356395.1 |
Coordinates | 4659298..4659588 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ124_RS22075 (4654921) | 4654921..4655823 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
LQ124_RS22080 (4655820) | 4655820..4656455 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
LQ124_RS22085 (4656452) | 4656452..4657381 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
LQ124_RS22090 (4657563) | 4657563..4657805 | - | 243 | WP_001306649.1 | protein YiiF | - |
LQ124_RS22095 (4658024) | 4658024..4658242 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
LQ124_RS22100 (4658661) | 4658661..4658939 | - | 279 | WP_001306650.1 | hypothetical protein | - |
LQ124_RS22105 (4659001) | 4659001..4659213 | - | 213 | WP_001590960.1 | hypothetical protein | - |
LQ124_RS22110 (4659298) | 4659298..4659588 | - | 291 | WP_000356395.1 | NadS family protein | Antitoxin |
LQ124_RS22115 (4659589) | 4659589..4659900 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
LQ124_RS22120 (4660129) | 4660129..4661037 | + | 909 | WP_001306651.1 | alpha/beta hydrolase | - |
LQ124_RS22125 (4661206) | 4661206..4662120 | - | 915 | WP_175085386.1 | transposase | - |
LQ124_RS22130 (4662133) | 4662133..4663020 | - | 888 | Protein_4328 | hypothetical protein | - |
LQ124_RS22135 (4663435) | 4663435..4664376 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
LQ124_RS22140 (4664421) | 4664421..4664858 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T295771 WP_000897305.1 NZ_OW967178:c4659900-4659589 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|