Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2543467..2543651 | Replicon | chromosome |
| Accession | NC_021554 | ||
| Organism | Staphylococcus aureus CA-347 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
| Locus tag | CA347_RS13010 | Protein ID | WP_000482647.1 |
| Coordinates | 2543544..2543651 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2543467..2543527 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CA347_RS12990 | 2539053..2539220 | - | 168 | WP_031785511.1 | hypothetical protein | - |
| CA347_RS13000 | 2539451..2541184 | - | 1734 | WP_000488492.1 | ABC transporter ATP-binding protein/permease | - |
| CA347_RS13005 | 2541233..2542972 | - | 1740 | WP_001064831.1 | ABC transporter ATP-binding protein/permease | - |
| CA347_RS15620 | 2543350..2543517 | - | 168 | WP_000301894.1 | hypothetical protein | - |
| - | 2543467..2543527 | + | 61 | - | - | Antitoxin |
| CA347_RS13010 | 2543544..2543651 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| CA347_RS13015 | 2543785..2544171 | - | 387 | WP_000779354.1 | flippase GtxA | - |
| CA347_RS13020 | 2544439..2545581 | + | 1143 | WP_001176860.1 | glycerate kinase | - |
| CA347_RS13025 | 2545641..2546300 | + | 660 | WP_000831298.1 | membrane protein | - |
| CA347_RS13030 | 2546480..2547691 | + | 1212 | WP_001191975.1 | multidrug effflux MFS transporter | - |
| CA347_RS13035 | 2547814..2548287 | - | 474 | WP_000456491.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T29577 WP_000482647.1 NC_021554:c2543651-2543544 [Staphylococcus aureus CA-347]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T29577 NC_021554:c2543651-2543544 [Staphylococcus aureus CA-347]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT29577 NC_021554:2543467-2543527 [Staphylococcus aureus CA-347]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|