Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3793937..3794631 Replicon chromosome
Accession NZ_OW967178
Organism Escherichia coli isolate 362

Toxin (Protein)


Gene name yafO Uniprot ID A0A0D8WHS4
Locus tag LQ124_RS18105 Protein ID WP_001521903.1
Coordinates 3793937..3794335 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1QAE3
Locus tag LQ124_RS18110 Protein ID WP_000554758.1
Coordinates 3794338..3794631 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (3789767) 3789767..3789847 - 81 NuclAT_10 - -
- (3789767) 3789767..3789847 - 81 NuclAT_10 - -
- (3789767) 3789767..3789847 - 81 NuclAT_10 - -
- (3789767) 3789767..3789847 - 81 NuclAT_10 - -
LQ124_RS18075 (3789107) 3789107..3790351 - 1245 WP_230133202.1 esterase FrsA -
LQ124_RS18080 (3790443) 3790443..3790901 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
LQ124_RS18085 (3791162) 3791162..3792619 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
LQ124_RS18090 (3792676) 3792676..3793028 - 353 Protein_3546 peptide chain release factor H -
LQ124_RS18095 (3793024) 3793024..3793230 - 207 Protein_3547 RtcB family protein -
LQ124_RS18100 (3793475) 3793475..3793927 - 453 WP_023144376.1 GNAT family N-acetyltransferase -
LQ124_RS18105 (3793937) 3793937..3794335 - 399 WP_001521903.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
LQ124_RS18110 (3794338) 3794338..3794631 - 294 WP_000554758.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
LQ124_RS18115 (3794683) 3794683..3795738 - 1056 WP_001226177.1 DNA polymerase IV -
LQ124_RS18120 (3795809) 3795809..3796732 - 924 WP_001570971.1 putative lateral flagellar export/assembly protein LafU -
LQ124_RS18125 (3796735) 3796735..3797598 - 864 WP_001169518.1 flagellar motor stator protein MotA -
LQ124_RS18130 (3797611) 3797611..3798330 - 720 WP_001589752.1 FliA/WhiG family RNA polymerase sigma factor -
LQ124_RS18135 (3798350) 3798350..3798817 - 468 WP_000725257.1 flagellar basal body-associated FliL family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 3793475..3818189 24714


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15471.88 Da        Isoelectric Point: 8.0949

>T295767 WP_001521903.1 NZ_OW967178:c3794335-3793937 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.76 Da        Isoelectric Point: 5.2170

>AT295767 WP_000554758.1 NZ_OW967178:c3794631-3794338 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D8WHS4

Antitoxin

Source ID Structure
AlphaFold DB S1QAE3

References