Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3793937..3794631 | Replicon | chromosome |
| Accession | NZ_OW967178 | ||
| Organism | Escherichia coli isolate 362 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | A0A0D8WHS4 |
| Locus tag | LQ124_RS18105 | Protein ID | WP_001521903.1 |
| Coordinates | 3793937..3794335 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | LQ124_RS18110 | Protein ID | WP_000554758.1 |
| Coordinates | 3794338..3794631 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (3789767) | 3789767..3789847 | - | 81 | NuclAT_10 | - | - |
| - (3789767) | 3789767..3789847 | - | 81 | NuclAT_10 | - | - |
| - (3789767) | 3789767..3789847 | - | 81 | NuclAT_10 | - | - |
| - (3789767) | 3789767..3789847 | - | 81 | NuclAT_10 | - | - |
| LQ124_RS18075 (3789107) | 3789107..3790351 | - | 1245 | WP_230133202.1 | esterase FrsA | - |
| LQ124_RS18080 (3790443) | 3790443..3790901 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| LQ124_RS18085 (3791162) | 3791162..3792619 | + | 1458 | WP_001293009.1 | cytosol nonspecific dipeptidase | - |
| LQ124_RS18090 (3792676) | 3792676..3793028 | - | 353 | Protein_3546 | peptide chain release factor H | - |
| LQ124_RS18095 (3793024) | 3793024..3793230 | - | 207 | Protein_3547 | RtcB family protein | - |
| LQ124_RS18100 (3793475) | 3793475..3793927 | - | 453 | WP_023144376.1 | GNAT family N-acetyltransferase | - |
| LQ124_RS18105 (3793937) | 3793937..3794335 | - | 399 | WP_001521903.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| LQ124_RS18110 (3794338) | 3794338..3794631 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| LQ124_RS18115 (3794683) | 3794683..3795738 | - | 1056 | WP_001226177.1 | DNA polymerase IV | - |
| LQ124_RS18120 (3795809) | 3795809..3796732 | - | 924 | WP_001570971.1 | putative lateral flagellar export/assembly protein LafU | - |
| LQ124_RS18125 (3796735) | 3796735..3797598 | - | 864 | WP_001169518.1 | flagellar motor stator protein MotA | - |
| LQ124_RS18130 (3797611) | 3797611..3798330 | - | 720 | WP_001589752.1 | FliA/WhiG family RNA polymerase sigma factor | - |
| LQ124_RS18135 (3798350) | 3798350..3798817 | - | 468 | WP_000725257.1 | flagellar basal body-associated FliL family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3793475..3818189 | 24714 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15471.88 Da Isoelectric Point: 8.0949
>T295767 WP_001521903.1 NZ_OW967178:c3794335-3793937 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0D8WHS4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1QAE3 |