Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1116622..1117349 | Replicon | chromosome |
| Accession | NZ_OW967178 | ||
| Organism | Escherichia coli isolate 362 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V0YLE2 |
| Locus tag | LQ124_RS05280 | Protein ID | WP_000547555.1 |
| Coordinates | 1116622..1116933 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | LQ124_RS05285 | Protein ID | WP_000126294.1 |
| Coordinates | 1116930..1117349 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ124_RS05255 (1112557) | 1112557..1114266 | + | 1710 | WP_001288122.1 | formate hydrogenlyase subunit HycE | - |
| LQ124_RS05260 (1114276) | 1114276..1114818 | + | 543 | WP_000493785.1 | formate hydrogenlyase subunit HycF | - |
| LQ124_RS05265 (1114818) | 1114818..1115585 | + | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
| LQ124_RS05270 (1115582) | 1115582..1115992 | + | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
| LQ124_RS05275 (1115985) | 1115985..1116455 | + | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
| LQ124_RS05280 (1116622) | 1116622..1116933 | + | 312 | WP_000547555.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| LQ124_RS05285 (1116930) | 1116930..1117349 | + | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
| LQ124_RS05290 (1117428) | 1117428..1118852 | - | 1425 | WP_000110355.1 | 6-phospho-beta-glucosidase AscB | - |
| LQ124_RS05295 (1118861) | 1118861..1120318 | - | 1458 | WP_001107889.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
| LQ124_RS05300 (1120578) | 1120578..1121588 | + | 1011 | WP_032141326.1 | DNA-binding transcriptional regulator AscG | - |
| LQ124_RS05305 (1121737) | 1121737..1122264 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12439.18 Da Isoelectric Point: 9.5146
>T295757 WP_000547555.1 NZ_OW967178:1116622-1116933 [Escherichia coli]
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT295757 WP_000126294.1 NZ_OW967178:1116930-1117349 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|