Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 623340..624139 | Replicon | chromosome |
Accession | NZ_OW967178 | ||
Organism | Escherichia coli isolate 362 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | LQ124_RS02990 | Protein ID | WP_000347273.1 |
Coordinates | 623340..623804 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | V0YUB5 |
Locus tag | LQ124_RS02995 | Protein ID | WP_001309780.1 |
Coordinates | 623804..624139 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ124_RS02960 (618341) | 618341..618775 | - | 435 | WP_000948818.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
LQ124_RS02965 (618793) | 618793..619671 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
LQ124_RS02970 (619661) | 619661..620440 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
LQ124_RS02975 (620451) | 620451..620924 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
LQ124_RS02980 (620947) | 620947..622227 | - | 1281 | WP_000681959.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
LQ124_RS02985 (622476) | 622476..623285 | + | 810 | WP_000072171.1 | aga operon transcriptional regulator AgaR | - |
LQ124_RS02990 (623340) | 623340..623804 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
LQ124_RS02995 (623804) | 623804..624139 | - | 336 | WP_001309780.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
LQ124_RS03000 (624288) | 624288..625859 | - | 1572 | WP_001273738.1 | galactarate dehydratase | - |
LQ124_RS03005 (626234) | 626234..627568 | + | 1335 | WP_000599654.1 | galactarate/glucarate/glycerate transporter GarP | - |
LQ124_RS03010 (627584) | 627584..628354 | + | 771 | WP_001590759.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T295755 WP_000347273.1 NZ_OW967178:c623804-623340 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|