Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 3875162..3875961 | Replicon | chromosome |
Accession | NZ_OW967003 | ||
Organism | Escherichia coli isolate 624 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | LQ179_RS18620 | Protein ID | WP_000347273.1 |
Coordinates | 3875162..3875626 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | D6JF08 |
Locus tag | LQ179_RS18625 | Protein ID | WP_001308975.1 |
Coordinates | 3875626..3875961 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ179_RS18590 (3870163) | 3870163..3870597 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
LQ179_RS18595 (3870615) | 3870615..3871493 | - | 879 | WP_001298314.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
LQ179_RS18600 (3871483) | 3871483..3872262 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
LQ179_RS18605 (3872273) | 3872273..3872746 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
LQ179_RS18610 (3872769) | 3872769..3874049 | - | 1281 | WP_023908831.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
LQ179_RS18615 (3874298) | 3874298..3875107 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
LQ179_RS18620 (3875162) | 3875162..3875626 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
LQ179_RS18625 (3875626) | 3875626..3875961 | - | 336 | WP_001308975.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
LQ179_RS18630 (3876110) | 3876110..3877681 | - | 1572 | WP_023908830.1 | galactarate dehydratase | - |
LQ179_RS18635 (3878056) | 3878056..3879390 | + | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
LQ179_RS18640 (3879406) | 3879406..3880176 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T295746 WP_000347273.1 NZ_OW967003:c3875626-3875162 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|