Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 2069525..2070219 | Replicon | chromosome |
| Accession | NZ_OW967003 | ||
| Organism | Escherichia coli isolate 624 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q0T7Q5 |
| Locus tag | LQ179_RS10045 | Protein ID | WP_001263491.1 |
| Coordinates | 2069525..2069923 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | L4JHF0 |
| Locus tag | LQ179_RS10050 | Protein ID | WP_000554755.1 |
| Coordinates | 2069926..2070219 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ179_RS10015 (2064787) | 2064787..2066244 | + | 1458 | WP_022645227.1 | cytosol nonspecific dipeptidase | - |
| LQ179_RS10020 (2066253) | 2066253..2066534 | + | 282 | WP_022645226.1 | hypothetical protein | - |
| LQ179_RS10025 (2066551) | 2066551..2067060 | - | 510 | WP_001361775.1 | metal-dependent hydrolase | - |
| LQ179_RS10030 (2067122) | 2067122..2067736 | - | 615 | WP_022645225.1 | peptide chain release factor H | - |
| LQ179_RS10035 (2067733) | 2067733..2068872 | - | 1140 | WP_022645224.1 | RNA ligase RtcB family protein | - |
| LQ179_RS10040 (2069063) | 2069063..2069515 | - | 453 | WP_023909048.1 | GNAT family N-acetyltransferase | - |
| LQ179_RS10045 (2069525) | 2069525..2069923 | - | 399 | WP_001263491.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| LQ179_RS10050 (2069926) | 2069926..2070219 | - | 294 | WP_000554755.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| LQ179_RS10055 (2070271) | 2070271..2071326 | - | 1056 | WP_022645222.1 | DNA polymerase IV | - |
| LQ179_RS10060 (2071397) | 2071397..2072182 | - | 786 | WP_072224360.1 | putative lateral flagellar export/assembly protein LafU | - |
| LQ179_RS10065 (2072154) | 2072154..2073866 | + | 1713 | Protein_1979 | flagellar biosynthesis protein FlhA | - |
| LQ179_RS10070 (2073964) | 2073964..2074737 | - | 774 | WP_022645219.1 | C40 family peptidase | - |
| LQ179_RS10075 (2074923) | 2074923..2075183 | + | 261 | WP_000729708.1 | type II toxin-antitoxin system antitoxin DinJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15457.86 Da Isoelectric Point: 8.0949
>T295740 WP_001263491.1 NZ_OW967003:c2069923-2069525 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TPK7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829G9H5 |