Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 1844827..1845506 | Replicon | chromosome |
Accession | NZ_OW967003 | ||
Organism | Escherichia coli isolate 624 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A0A1A1R1 |
Locus tag | LQ179_RS08990 | Protein ID | WP_000057541.1 |
Coordinates | 1845204..1845506 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | LQ179_RS08985 | Protein ID | WP_000806442.1 |
Coordinates | 1844827..1845168 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ179_RS08975 (1841070) | 1841070..1842002 | - | 933 | WP_000883035.1 | glutaminase A | - |
LQ179_RS08980 (1842265) | 1842265..1844769 | + | 2505 | WP_077737757.1 | copper-exporting P-type ATPase CopA | - |
LQ179_RS08985 (1844827) | 1844827..1845168 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
LQ179_RS08990 (1845204) | 1845204..1845506 | - | 303 | WP_000057541.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LQ179_RS08995 (1845639) | 1845639..1846433 | + | 795 | WP_000365164.1 | TraB/GumN family protein | - |
LQ179_RS09000 (1846637) | 1846637..1847116 | + | 480 | WP_000186627.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
LQ179_RS09005 (1847153) | 1847153..1848805 | - | 1653 | Protein_1769 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
LQ179_RS09010 (1849023) | 1849023..1850243 | + | 1221 | WP_001251634.1 | fosmidomycin MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11795.37 Da Isoelectric Point: 10.2638
>T295738 WP_000057541.1 NZ_OW967003:c1845506-1845204 [Escherichia coli]
MAQKNNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKNNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A1A1R1 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 2EBY | |
AlphaFold DB | S1QAY3 |