Detailed information of TA system TA295699

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 119619..120045
• Replicon: plasmid P1
• Accession: NZ_OW849378
• Organism: Escherichia coli isolate 162

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: LQ158_RS23815
• Protein ID: WP_001372321.1
• Coordinates: 119619..119744 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	119821..120045 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
LQ158_RS23770 (114685)	114685..114858	-	174	WP_230133086.1	TraY domain-containing protein	-
LQ158_RS23775 (114993)	114993..115682	-	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
LQ158_RS23780 (115869)	115869..116252	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
LQ158_RS23785 (116573)	116573..117175	+	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
LQ158_RS23790 (117472)	117472..118293	-	822	WP_001234426.1	DUF932 domain-containing protein	-
LQ158_RS23795 (118411)	118411..118698	-	288	WP_000107535.1	hypothetical protein	-
LQ158_RS23800 (118723)	118723..118929	-	207	WP_000547968.1	hypothetical protein	-
LQ158_RS23805 (118999)	118999..119171	+	173	Protein_132	hypothetical protein	-
LQ158_RS23810 (119169)	119169..119399	-	231	WP_230133084.1	hypothetical protein	-
LQ158_RS23815 (119619)	119619..119744	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
LQ158_RS23820 (119686)	119686..119835	-	150	Protein_135	plasmid maintenance protein Mok	-
- (119821)	119821..120045	-	225	NuclAT_0	-	Antitoxin
- (119821)	119821..120045	-	225	NuclAT_0	-	Antitoxin
- (119821)	119821..120045	-	225	NuclAT_0	-	Antitoxin
- (119821)	119821..120045	-	225	NuclAT_0	-	Antitoxin
LQ158_RS23825 (119857)	119857..120045	+	189	WP_001299721.1	hypothetical protein	-
LQ158_RS23830 (120014)	120014..120776	-	763	Protein_137	plasmid SOS inhibition protein A	-
LQ158_RS23835 (120773)	120773..121207	-	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
LQ158_RS23840 (121262)	121262..121459	-	198	Protein_139	hypothetical protein	-
LQ158_RS23845 (121487)	121487..121720	-	234	WP_000005987.1	DUF905 family protein	-
LQ158_RS23850 (121788)	121788..122327	-	540	WP_000290840.1	single-stranded DNA-binding protein	-
LQ158_RS23855 (122353)	122353..122559	-	207	WP_000275856.1	hypothetical protein	-
LQ158_RS23860 (122629)	122629..122709	+	81	Protein_143	hypothetical protein	-
LQ158_RS23865 (122892)	122892..123061	-	170	Protein_144	hypothetical protein	-
LQ158_RS23870 (123698)	123698..124669	-	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaTEM-1B / sul3 / ant(3'')-Ia / dfrA1 / tet(A) / sitABCD	iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA	1..145050	145050

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T295699 WP_001372321.1 NZ_OW849378:c119744-119619 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT295699 NZ_OW849378:c120045-119821 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin