Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 79952..80206 | Replicon | plasmid P1 |
| Accession | NZ_OW849378 | ||
| Organism | Escherichia coli isolate 162 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | LQ158_RS23570 | Protein ID | WP_001312851.1 |
| Coordinates | 79952..80101 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 80145..80206 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ158_RS23520 (75193) | 75193..75345 | + | 153 | Protein_75 | IS4 family transposase | - |
| LQ158_RS23525 (75505) | 75505..75906 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| LQ158_RS23530 (75839) | 75839..76096 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| LQ158_RS23535 (76189) | 76189..76842 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| LQ158_RS23540 (76940) | 76940..77080 | - | 141 | WP_001333237.1 | hypothetical protein | - |
| LQ158_RS23545 (77780) | 77780..78637 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| LQ158_RS23550 (78630) | 78630..79112 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| LQ158_RS23555 (79105) | 79105..79152 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| LQ158_RS23560 (79143) | 79143..79394 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| LQ158_RS23565 (79411) | 79411..79668 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| LQ158_RS23570 (79952) | 79952..80101 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (80145) | 80145..80206 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (80145) | 80145..80206 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (80145) | 80145..80206 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (80145) | 80145..80206 | + | 62 | NuclAT_1 | - | Antitoxin |
| LQ158_RS23575 (80462) | 80462..80536 | - | 75 | Protein_86 | endonuclease | - |
| LQ158_RS23580 (80782) | 80782..80994 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| LQ158_RS23585 (81130) | 81130..81690 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| LQ158_RS23590 (81793) | 81793..82653 | - | 861 | WP_000704514.1 | alpha/beta hydrolase | - |
| LQ158_RS23595 (82712) | 82712..83458 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / sul3 / ant(3'')-Ia / dfrA1 / tet(A) / sitABCD | iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA | 1..145050 | 145050 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T295694 WP_001312851.1 NZ_OW849378:c80101-79952 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT295694 NZ_OW849378:80145-80206 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|