Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4609801..4610403 | Replicon | chromosome |
| Accession | NZ_OW849377 | ||
| Organism | Escherichia coli isolate 162 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | LQ158_RS22160 | Protein ID | WP_000897305.1 |
| Coordinates | 4610092..4610403 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | LQ158_RS22155 | Protein ID | WP_000356397.1 |
| Coordinates | 4609801..4610091 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ158_RS22130 (4605727) | 4605727..4606629 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| LQ158_RS22135 (4606626) | 4606626..4607261 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| LQ158_RS22140 (4607258) | 4607258..4608187 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
| LQ158_RS22145 (4608517) | 4608517..4608759 | - | 243 | WP_001086388.1 | protein YiiF | - |
| LQ158_RS22150 (4608978) | 4608978..4609196 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
| LQ158_RS22155 (4609801) | 4609801..4610091 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| LQ158_RS22160 (4610092) | 4610092..4610403 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| LQ158_RS22165 (4610632) | 4610632..4611540 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
| LQ158_RS22170 (4611604) | 4611604..4612545 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| LQ158_RS22175 (4612590) | 4612590..4613027 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| LQ158_RS22180 (4613024) | 4613024..4613896 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| LQ158_RS22185 (4613890) | 4613890..4614489 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
| LQ158_RS22190 (4614588) | 4614588..4615373 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T295693 WP_000897305.1 NZ_OW849377:c4610403-4610092 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|