Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 1249623..1250272 | Replicon | chromosome |
Accession | NZ_OW849195 | ||
Organism | Enterobacter cloacae isolate 125 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | LQ145_RS06170 | Protein ID | WP_023332294.1 |
Coordinates | 1249910..1250272 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A2W0GCS7 |
Locus tag | LQ145_RS06165 | Protein ID | WP_014882863.1 |
Coordinates | 1249623..1249922 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ145_RS06155 (AI2762V1_1198) | 1246048..1248021 | + | 1974 | WP_023332292.1 | PhoX family phosphatase | - |
LQ145_RS06160 (AI2762V1_1199) | 1248124..1249512 | + | 1389 | WP_023332293.1 | phenylalanine transporter | - |
LQ145_RS06165 (AI2762V1_1200) | 1249623..1249922 | - | 300 | WP_014882863.1 | helix-turn-helix transcriptional regulator | Antitoxin |
LQ145_RS06170 (AI2762V1_1201) | 1249910..1250272 | - | 363 | WP_023332294.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LQ145_RS06175 (AI2762V1_1202) | 1250478..1251713 | + | 1236 | WP_023332295.1 | MFS transporter | - |
LQ145_RS06180 (AI2762V1_1203) | 1251729..1252754 | + | 1026 | WP_023332296.1 | sugar phosphate isomerase/epimerase | - |
LQ145_RS06185 (AI2762V1_1204) | 1252747..1253889 | + | 1143 | WP_023332297.1 | Gfo/Idh/MocA family oxidoreductase | - |
LQ145_RS06190 (AI2762V1_1205) | 1253965..1254936 | + | 972 | WP_014882868.1 | LacI family DNA-binding transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13953.90 Da Isoelectric Point: 6.2260
>T295666 WP_023332294.1 NZ_OW849195:c1250272-1249910 [Enterobacter cloacae]
MWNVETTDRFDQWYFEQTTALKEDVLAMMHILAEFGPTLGRPYVDTVKASAYANMKELRIQHAGNPIRAFFAFDPDRKAI
VLCAGDKTGCNQKRFYNEMITLADVEYSRHLADKEAIWQR
MWNVETTDRFDQWYFEQTTALKEDVLAMMHILAEFGPTLGRPYVDTVKASAYANMKELRIQHAGNPIRAFFAFDPDRKAI
VLCAGDKTGCNQKRFYNEMITLADVEYSRHLADKEAIWQR
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|