Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 33039..33769 | Replicon | chromosome |
| Accession | NZ_OW849195 | ||
| Organism | Enterobacter cloacae isolate 125 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A2W0GI63 |
| Locus tag | LQ145_RS00155 | Protein ID | WP_023331686.1 |
| Coordinates | 33039..33353 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | LQ145_RS00160 | Protein ID | WP_023331687.1 |
| Coordinates | 33350..33769 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ145_RS00135 (AI2762V1_0028) | 28371..29555 | - | 1185 | WP_032629627.1 | multidrug efflux MFS transporter EmrD | - |
| LQ145_RS00140 (AI2762V1_0029) | 29731..30564 | - | 834 | WP_023331683.1 | EamA family transporter | - |
| LQ145_RS00145 (AI2762V1_0030) | 30627..31073 | - | 447 | WP_023331684.1 | GNAT family N-acetyltransferase | - |
| LQ145_RS00150 (AI2762V1_0032) | 31471..32691 | - | 1221 | WP_000343760.1 | ISL3-like element ISKox3 family transposase | - |
| LQ145_RS00155 (AI2762V1_0033) | 33039..33353 | + | 315 | WP_023331686.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| LQ145_RS00160 (AI2762V1_0034) | 33350..33769 | + | 420 | WP_023331687.1 | helix-turn-helix domain-containing protein | Antitoxin |
| LQ145_RS00165 | 33919..34017 | + | 99 | WP_023331688.1 | ilvB operon leader peptide IvbL | - |
| LQ145_RS00170 (AI2762V1_0035) | 34124..35812 | + | 1689 | WP_023331689.1 | acetolactate synthase large subunit | - |
| LQ145_RS00175 (AI2762V1_0036) | 35816..36103 | + | 288 | WP_010426528.1 | acetolactate synthase small subunit | - |
| LQ145_RS00180 (AI2762V1_0037) | 36186..36779 | + | 594 | WP_014881931.1 | transcriptional regulator UhpA | - |
| LQ145_RS00185 (AI2762V1_0038) | 36776..38281 | + | 1506 | WP_023331690.1 | signal transduction histidine-protein kinase/phosphatase UhpB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 31471..32691 | 1220 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12441.59 Da Isoelectric Point: 10.2825
>T295663 WP_023331686.1 NZ_OW849195:33039-33353 [Enterobacter cloacae]
MHLISMKAILDAVIQFPQHREELLFLGRTIEKSHCTTPVALRKIFPTLDNLKYLDKHYVIDIANNNLRVVALIFFESQKF
YVRHVFTHKEYDRFTEKHRTKGKK
MHLISMKAILDAVIQFPQHREELLFLGRTIEKSHCTTPVALRKIFPTLDNLKYLDKHYVIDIANNNLRVVALIFFESQKF
YVRHVFTHKEYDRFTEKHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15561.18 Da Isoelectric Point: 5.6761
>AT295663 WP_023331687.1 NZ_OW849195:33350-33769 [Enterobacter cloacae]
MMIVADAMKATHALVAAVPLLGEHPNEKDYQDALELVEYLLMNEPGSPLLDIVCARIRRYEANRPEIVALRQEMESVPVG
IAVLRTLMDQYKLTISDFQDEIGSKSMVSRVLNGQRQLTLNHIKKLAARFGVSPALFIE
MMIVADAMKATHALVAAVPLLGEHPNEKDYQDALELVEYLLMNEPGSPLLDIVCARIRRYEANRPEIVALRQEMESVPVG
IAVLRTLMDQYKLTISDFQDEIGSKSMVSRVLNGQRQLTLNHIKKLAARFGVSPALFIE
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|