Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 2048116..2048979 | Replicon | chromosome |
| Accession | NZ_OW849082 | ||
| Organism | Citrobacter freundii isolate 8 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | A0A7W3E442 |
| Locus tag | LQ154_RS10040 | Protein ID | WP_044702672.1 |
| Coordinates | 2048116..2048610 (-) | Length | 165 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | A0A5B0SRB7 |
| Locus tag | LQ154_RS10045 | Protein ID | WP_044702675.1 |
| Coordinates | 2048635..2048979 (-) | Length | 115 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ154_RS10025 (2045614) | 2045614..2046450 | + | 837 | Protein_1963 | Tn3 family transposase | - |
| LQ154_RS10030 (2046447) | 2046447..2047043 | - | 597 | WP_230129643.1 | hypothetical protein | - |
| LQ154_RS10035 (2047141) | 2047141..2047389 | - | 249 | WP_044702684.1 | hypothetical protein | - |
| LQ154_RS10040 (2048116) | 2048116..2048610 | - | 495 | WP_044702672.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
| LQ154_RS10045 (2048635) | 2048635..2048979 | - | 345 | WP_044702675.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
| LQ154_RS10050 (2049416) | 2049416..2049646 | - | 231 | WP_044702671.1 | hypothetical protein | - |
| LQ154_RS10055 (2049637) | 2049637..2049900 | - | 264 | WP_044702670.1 | DUF1380 family protein | - |
| LQ154_RS10060 (2050007) | 2050007..2050288 | - | 282 | WP_044702669.1 | hypothetical protein | - |
| LQ154_RS10065 (2050436) | 2050436..2050954 | - | 519 | WP_044702667.1 | hypothetical protein | - |
| LQ154_RS10070 (2050944) | 2050944..2051318 | - | 375 | WP_044702665.1 | hypothetical protein | - |
| LQ154_RS10075 (2051328) | 2051328..2051657 | - | 330 | WP_044702664.1 | hypothetical protein | - |
| LQ154_RS10080 (2051671) | 2051671..2051940 | - | 270 | WP_044702662.1 | hypothetical protein | - |
| LQ154_RS10085 (2052049) | 2052049..2052480 | - | 432 | WP_049002914.1 | antirestriction protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | blaTEM-1A / aac(3)-IIa / blaTEM-1B | - | 2031035..2069815 | 38780 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 19076.90 Da Isoelectric Point: 8.2557
>T295636 WP_044702672.1 NZ_OW849082:c2048610-2048116 [Citrobacter freundii]
MEYLEINGWKICFHKCFLDQITELAKKVAELKAAKPSEYHTKKETKLLRAIERVIEEWIASDPLNPQYRQGETLGDEYKH
WFRVKFLQQFRLFFRCSQEHKTIIIGWVNDFGTLRAYGSKTDAYKVFAAMLDAGNPPDDWDKLLNAATKATATASIPDFL
TRQP
MEYLEINGWKICFHKCFLDQITELAKKVAELKAAKPSEYHTKKETKLLRAIERVIEEWIASDPLNPQYRQGETLGDEYKH
WFRVKFLQQFRLFFRCSQEHKTIIIGWVNDFGTLRAYGSKTDAYKVFAAMLDAGNPPDDWDKLLNAATKATATASIPDFL
TRQP
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7W3E442 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5B0SRB7 |