Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 40129..40777 | Replicon | chromosome |
| Accession | NZ_OW849082 | ||
| Organism | Citrobacter freundii isolate 8 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A0D7M266 |
| Locus tag | LQ154_RS00185 | Protein ID | WP_016151211.1 |
| Coordinates | 40129..40491 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A0D7LEH2 |
| Locus tag | LQ154_RS00190 | Protein ID | WP_003840660.1 |
| Coordinates | 40478..40777 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ154_RS00170 (36588) | 36588..37916 | + | 1329 | WP_003023927.1 | MFS transporter | - |
| LQ154_RS00175 (38059) | 38059..39450 | + | 1392 | WP_003023929.1 | hexose-6-phosphate:phosphate antiporter | - |
| LQ154_RS00180 (39576) | 39576..40028 | + | 453 | WP_003023933.1 | DUF1198 family protein | - |
| LQ154_RS00185 (40129) | 40129..40491 | + | 363 | WP_016151211.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LQ154_RS00190 (40478) | 40478..40777 | + | 300 | WP_003840660.1 | XRE family transcriptional regulator | Antitoxin |
| LQ154_RS00195 (40896) | 40896..42089 | + | 1194 | WP_003840662.1 | purine ribonucleoside efflux pump NepI | - |
| LQ154_RS00200 (42138) | 42138..43520 | - | 1383 | WP_016151210.1 | glycoside hydrolase family 1 protein | - |
| LQ154_RS00205 (43615) | 43615..43908 | - | 294 | WP_003840665.1 | YicS family protein | - |
| LQ154_RS00210 (44039) | 44039..44455 | + | 417 | WP_003023951.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13788.66 Da Isoelectric Point: 5.1976
>T295631 WP_016151211.1 NZ_OW849082:40129-40491 [Citrobacter freundii]
MWEVETTDAFDKWFDVQTEALKEDMLAAMMILSEYGPQLGRPFADTVNASAFSNMKELRVQHQGSPIRAFFAFDPSRHGI
VLCAGDKTGLNEKKFYKEMIRLADAEYRNHLISKENYGYP
MWEVETTDAFDKWFDVQTEALKEDMLAAMMILSEYGPQLGRPFADTVNASAFSNMKELRVQHQGSPIRAFFAFDPSRHGI
VLCAGDKTGLNEKKFYKEMIRLADAEYRNHLISKENYGYP
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0D7M266 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0D7LEH2 |