Detailed information of TA system TA295629

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 100913..101339
• Replicon: plasmid P1
• Accession: NZ_OW849065
• Organism: Escherichia coli isolate 131

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: LQ135_RS26175
• Protein ID: WP_001372321.1
• Coordinates: 101214..101339 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	100913..101137 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
LQ135_RS26140 (96905)	96905..97390	+	486	WP_042029316.1	single-stranded DNA-binding protein	-
LQ135_RS26145 (97446)	97446..97679	+	234	WP_000006004.1	DUF905 domain-containing protein	-
LQ135_RS26150 (97738)	97738..99696	+	1959	WP_200121858.1	ParB/RepB/Spo0J family partition protein	-
LQ135_RS26155 (99751)	99751..100185	+	435	WP_000845901.1	conjugation system SOS inhibitor PsiB	-
LQ135_RS26160 (100182)	100182..100944	+	763	Protein_119	plasmid SOS inhibition protein A	-
LQ135_RS26165 (100913)	100913..101101	-	189	WP_001299721.1	hypothetical protein	-
- (100913)	100913..101137	+	225	NuclAT_0	-	Antitoxin
- (100913)	100913..101137	+	225	NuclAT_0	-	Antitoxin
- (100913)	100913..101137	+	225	NuclAT_0	-	Antitoxin
- (100913)	100913..101137	+	225	NuclAT_0	-	Antitoxin
LQ135_RS26170 (101123)	101123..101272	+	150	Protein_121	plasmid maintenance protein Mok	-
LQ135_RS26175 (101214)	101214..101339	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
LQ135_RS26180 (101559)	101559..101789	+	231	WP_071587244.1	hypothetical protein	-
LQ135_RS26185 (101787)	101787..101960	-	174	Protein_124	hypothetical protein	-
LQ135_RS26190 (102258)	102258..102545	+	288	WP_000107537.1	hypothetical protein	-
LQ135_RS26195 (102666)	102666..103487	+	822	WP_001234469.1	DUF932 domain-containing protein	-
LQ135_RS26200 (103784)	103784..104431	-	648	WP_000614282.1	transglycosylase SLT domain-containing protein	-
LQ135_RS26205 (104717)	104717..105100	+	384	WP_001151564.1	conjugal transfer relaxosome DNA-binding protein TraM	-
LQ135_RS26210 (105294)	105294..105980	+	687	WP_000332487.1	PAS domain-containing protein	-
LQ135_RS26215 (106074)	106074..106301	+	228	WP_001254388.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	tet(A) / blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / aadA5 / qacE / sul1	-	1..146311	146311

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T295629 WP_001372321.1 NZ_OW849065:101214-101339 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT295629 NZ_OW849065:100913-101137 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin