Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 4725552..4726231 | Replicon | chromosome |
| Accession | NZ_OW849064 | ||
| Organism | Escherichia coli isolate 131 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1PK60 |
| Locus tag | LQ135_RS23255 | Protein ID | WP_000057523.1 |
| Coordinates | 4725552..4725854 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1QAY3 |
| Locus tag | LQ135_RS23260 | Protein ID | WP_000806442.1 |
| Coordinates | 4725890..4726231 (+) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ135_RS23230 (4720928) | 4720928..4722580 | + | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
| LQ135_RS23235 (4722618) | 4722618..4723121 | - | 504 | WP_000667000.1 | hypothetical protein | - |
| LQ135_RS23240 (4723118) | 4723118..4723774 | - | 657 | WP_015674862.1 | hypothetical protein | - |
| LQ135_RS23245 (4723942) | 4723942..4724421 | - | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
| LQ135_RS23250 (4724625) | 4724625..4725419 | - | 795 | WP_000365147.1 | TraB/GumN family protein | - |
| LQ135_RS23255 (4725552) | 4725552..4725854 | + | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LQ135_RS23260 (4725890) | 4725890..4726231 | + | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
| LQ135_RS23265 (4726289) | 4726289..4728793 | - | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
| LQ135_RS23270 (4729055) | 4729055..4729987 | + | 933 | WP_000883041.1 | glutaminase A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T295624 WP_000057523.1 NZ_OW849064:4725552-4725854 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|