Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 4204915..4205173 | Replicon | chromosome |
Accession | NZ_OW849064 | ||
Organism | Escherichia coli isolate 131 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | LQ135_RS20800 | Protein ID | WP_000809168.1 |
Coordinates | 4204915..4205067 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 4205116..4205173 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ135_RS20780 | 4200162..4200875 | - | 714 | WP_001102393.1 | acidic protein MsyB | - |
LQ135_RS20785 | 4200901..4201305 | - | 405 | WP_000843689.1 | DUF2541 family protein | - |
LQ135_RS20790 | 4201676..4203592 | + | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
LQ135_RS20795 | 4203681..4204811 | + | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
LQ135_RS20800 | 4204915..4205067 | - | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
- | 4205116..4205173 | + | 58 | - | - | Antitoxin |
LQ135_RS20805 | 4205681..4206442 | + | 762 | WP_001274833.1 | outer membrane protein OmpK | - |
LQ135_RS20810 | 4206463..4207956 | + | 1494 | WP_001173016.1 | sulfatase-like hydrolase/transferase | - |
LQ135_RS20815 | 4208085..4209344 | + | 1260 | WP_000494928.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T295620 WP_000809168.1 NZ_OW849064:c4205067-4204915 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT295620 NZ_OW849064:4205116-4205173 [Escherichia coli]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|