Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 3494392..3494994 | Replicon | chromosome |
| Accession | NZ_OW849064 | ||
| Organism | Escherichia coli isolate 131 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | LQ135_RS17310 | Protein ID | WP_000897302.1 |
| Coordinates | 3494392..3494703 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | LQ135_RS17315 | Protein ID | WP_000356397.1 |
| Coordinates | 3494704..3494994 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ135_RS17285 (3490306) | 3490306..3490905 | + | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
| LQ135_RS17290 (3490899) | 3490899..3491771 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| LQ135_RS17295 (3491768) | 3491768..3492205 | + | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
| LQ135_RS17300 (3492250) | 3492250..3493191 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| LQ135_RS17305 (3493255) | 3493255..3494163 | - | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
| LQ135_RS17310 (3494392) | 3494392..3494703 | + | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| LQ135_RS17315 (3494704) | 3494704..3494994 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| LQ135_RS17320 (3495353) | 3495353..3495631 | + | 279 | WP_001296612.1 | hypothetical protein | - |
| LQ135_RS17325 (3496028) | 3496028..3496246 | + | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
| LQ135_RS17330 (3496431) | 3496431..3497171 | - | 741 | WP_000608806.1 | hypothetical protein | - |
| LQ135_RS17335 (3497196) | 3497196..3498044 | - | 849 | WP_001038650.1 | hypothetical protein | - |
| LQ135_RS17340 (3498334) | 3498334..3498576 | + | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
| LQ135_RS17345 (3498758) | 3498758..3499687 | - | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T295615 WP_000897302.1 NZ_OW849064:3494392-3494703 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|