Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 2614401..2615200 | Replicon | chromosome |
Accession | NZ_OW849064 | ||
Organism | Escherichia coli isolate 131 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | S1NYM6 |
Locus tag | LQ135_RS13025 | Protein ID | WP_000347251.1 |
Coordinates | 2614736..2615200 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1PPV5 |
Locus tag | LQ135_RS13020 | Protein ID | WP_001296435.1 |
Coordinates | 2614401..2614736 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ135_RS13005 (2610186) | 2610186..2610956 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
LQ135_RS13010 (2610972) | 2610972..2612306 | - | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
LQ135_RS13015 (2612681) | 2612681..2614252 | + | 1572 | WP_001273763.1 | galactarate dehydratase | - |
LQ135_RS13020 (2614401) | 2614401..2614736 | + | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
LQ135_RS13025 (2614736) | 2614736..2615200 | + | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
LQ135_RS13030 (2615255) | 2615255..2616064 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
LQ135_RS13035 (2616313) | 2616313..2617593 | + | 1281 | WP_000681950.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
LQ135_RS13040 (2617616) | 2617616..2618089 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
LQ135_RS13045 (2618100) | 2618100..2618879 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
LQ135_RS13050 (2618869) | 2618869..2619747 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
LQ135_RS13055 (2619765) | 2619765..2620199 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T295612 WP_000347251.1 NZ_OW849064:2614736-2615200 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJ20 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1PPV5 |