295597

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-sokC/Ldr(toxin)
Location 421382..421603 Replicon chromosome
Accession NZ_OW849064
Organism Escherichia coli isolate 131

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag LQ135_RS02305 Protein ID WP_001531632.1
Coordinates 421382..421489 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name sokC
Locus tag -
Coordinates 421537..421603 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ135_RS02280 (417226) 417226..418308 + 1083 WP_000804726.1 peptide chain release factor 1 -
LQ135_RS02285 (418308) 418308..419141 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
LQ135_RS02290 (419138) 419138..419530 + 393 WP_000200375.1 invasion regulator SirB2 -
LQ135_RS02295 (419534) 419534..420343 + 810 WP_001257044.1 invasion regulator SirB1 -
LQ135_RS02300 (420379) 420379..421233 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
LQ135_RS02305 (421382) 421382..421489 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (421539) 421539..421602 + 64 NuclAT_12 - -
- (421539) 421539..421602 + 64 NuclAT_12 - -
- (421539) 421539..421602 + 64 NuclAT_12 - -
- (421539) 421539..421602 + 64 NuclAT_12 - -
- (421539) 421539..421602 + 64 NuclAT_13 - -
- (421539) 421539..421602 + 64 NuclAT_13 - -
- (421539) 421539..421602 + 64 NuclAT_13 - -
- (421539) 421539..421602 + 64 NuclAT_13 - -
- (421539) 421539..421602 + 64 NuclAT_14 - -
- (421539) 421539..421602 + 64 NuclAT_14 - -
- (421539) 421539..421602 + 64 NuclAT_14 - -
- (421539) 421539..421602 + 64 NuclAT_14 - -
- (421539) 421539..421602 + 64 NuclAT_15 - -
- (421539) 421539..421602 + 64 NuclAT_15 - -
- (421539) 421539..421602 + 64 NuclAT_15 - -
- (421539) 421539..421602 + 64 NuclAT_15 - -
- (421539) 421539..421602 + 64 NuclAT_16 - -
- (421539) 421539..421602 + 64 NuclAT_16 - -
- (421539) 421539..421602 + 64 NuclAT_16 - -
- (421539) 421539..421602 + 64 NuclAT_16 - -
- (421539) 421539..421602 + 64 NuclAT_17 - -
- (421539) 421539..421602 + 64 NuclAT_17 - -
- (421539) 421539..421602 + 64 NuclAT_17 - -
- (421539) 421539..421602 + 64 NuclAT_17 - -
- (421537) 421537..421603 + 67 NuclAT_10 - Antitoxin
- (421537) 421537..421603 + 67 NuclAT_10 - Antitoxin
- (421537) 421537..421603 + 67 NuclAT_10 - Antitoxin
- (421537) 421537..421603 + 67 NuclAT_10 - Antitoxin
- (421537) 421537..421603 + 67 NuclAT_5 - Antitoxin
- (421537) 421537..421603 + 67 NuclAT_5 - Antitoxin
- (421537) 421537..421603 + 67 NuclAT_5 - Antitoxin
- (421537) 421537..421603 + 67 NuclAT_5 - Antitoxin
- (421537) 421537..421603 + 67 NuclAT_6 - Antitoxin
- (421537) 421537..421603 + 67 NuclAT_6 - Antitoxin
- (421537) 421537..421603 + 67 NuclAT_6 - Antitoxin
- (421537) 421537..421603 + 67 NuclAT_6 - Antitoxin
- (421537) 421537..421603 + 67 NuclAT_7 - Antitoxin
- (421537) 421537..421603 + 67 NuclAT_7 - Antitoxin
- (421537) 421537..421603 + 67 NuclAT_7 - Antitoxin
- (421537) 421537..421603 + 67 NuclAT_7 - Antitoxin
- (421537) 421537..421603 + 67 NuclAT_8 - Antitoxin
- (421537) 421537..421603 + 67 NuclAT_8 - Antitoxin
- (421537) 421537..421603 + 67 NuclAT_8 - Antitoxin
- (421537) 421537..421603 + 67 NuclAT_8 - Antitoxin
- (421537) 421537..421603 + 67 NuclAT_9 - Antitoxin
- (421537) 421537..421603 + 67 NuclAT_9 - Antitoxin
- (421537) 421537..421603 + 67 NuclAT_9 - Antitoxin
- (421537) 421537..421603 + 67 NuclAT_9 - Antitoxin
- (421539) 421539..421604 + 66 NuclAT_18 - -
- (421539) 421539..421604 + 66 NuclAT_18 - -
- (421539) 421539..421604 + 66 NuclAT_18 - -
- (421539) 421539..421604 + 66 NuclAT_18 - -
- (421539) 421539..421604 + 66 NuclAT_19 - -
- (421539) 421539..421604 + 66 NuclAT_19 - -
- (421539) 421539..421604 + 66 NuclAT_19 - -
- (421539) 421539..421604 + 66 NuclAT_19 - -
- (421539) 421539..421604 + 66 NuclAT_20 - -
- (421539) 421539..421604 + 66 NuclAT_20 - -
- (421539) 421539..421604 + 66 NuclAT_20 - -
- (421539) 421539..421604 + 66 NuclAT_20 - -
- (421539) 421539..421604 + 66 NuclAT_21 - -
- (421539) 421539..421604 + 66 NuclAT_21 - -
- (421539) 421539..421604 + 66 NuclAT_21 - -
- (421539) 421539..421604 + 66 NuclAT_21 - -
- (421539) 421539..421604 + 66 NuclAT_22 - -
- (421539) 421539..421604 + 66 NuclAT_22 - -
- (421539) 421539..421604 + 66 NuclAT_22 - -
- (421539) 421539..421604 + 66 NuclAT_22 - -
- (421539) 421539..421604 + 66 NuclAT_23 - -
- (421539) 421539..421604 + 66 NuclAT_23 - -
- (421539) 421539..421604 + 66 NuclAT_23 - -
- (421539) 421539..421604 + 66 NuclAT_23 - -
LQ135_RS02310 (421894) 421894..422994 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
LQ135_RS02315 (423264) 423264..423503 + 240 WP_000120702.1 putative cation transport regulator ChaB -
LQ135_RS02320 (423652) 423652..424347 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
LQ135_RS02325 (424391) 424391..424744 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
LQ135_RS02330 (424929) 424929..426323 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T295597 WP_001531632.1 NZ_OW849064:c421489-421382 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT295597 NZ_OW849064:421537-421603 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References