Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 50675..50939 Replicon plasmid P2
Accession NZ_OW848982
Organism Escherichia coli isolate 23

Toxin (Protein)


Gene name pndA Uniprot ID E6BRV3
Locus tag LQ157_RS24835 Protein ID WP_001303307.1
Coordinates 50787..50939 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 50675..50732 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ157_RS24820 (45914) 45914..48205 - 2292 WP_001289282.1 F-type conjugative transfer protein TrbC -
LQ157_RS24825 (48198) 48198..49268 - 1071 WP_000151582.1 IncI1-type conjugal transfer protein TrbB -
LQ157_RS24830 (49287) 49287..50495 - 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
- (50675) 50675..50732 - 58 NuclAT_0 - Antitoxin
- (50675) 50675..50732 - 58 NuclAT_0 - Antitoxin
- (50675) 50675..50732 - 58 NuclAT_0 - Antitoxin
- (50675) 50675..50732 - 58 NuclAT_0 - Antitoxin
LQ157_RS24835 (50787) 50787..50939 + 153 WP_001303307.1 Hok/Gef family protein Toxin
LQ157_RS24840 (51011) 51011..51262 - 252 WP_001291965.1 hypothetical protein -
LQ157_RS25465 (51761) 51761..51856 + 96 WP_001303310.1 DinQ-like type I toxin DqlB -
LQ157_RS24850 (51921) 51921..52097 - 177 WP_001054897.1 hypothetical protein -
LQ157_RS24855 (52489) 52489..52698 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
LQ157_RS24860 (52770) 52770..53420 - 651 WP_001178506.1 plasmid IncI1-type surface exclusion protein ExcA -
LQ157_RS24865 (53494) 53494..55662 - 2169 WP_000698357.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1B - 1..97252 97252


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5817.21 Da        Isoelectric Point: 8.7948

>T295593 WP_001303307.1 NZ_OW848982:50787-50939 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 58 bp

>AT295593 NZ_OW848982:c50732-50675 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A634Q5L1

Antitoxin

Download structure file

References