Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 50675..50939 | Replicon | plasmid P2 |
| Accession | NZ_OW848982 | ||
| Organism | Escherichia coli isolate 23 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | E6BRV3 |
| Locus tag | LQ157_RS24835 | Protein ID | WP_001303307.1 |
| Coordinates | 50787..50939 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 50675..50732 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ157_RS24820 (45914) | 45914..48205 | - | 2292 | WP_001289282.1 | F-type conjugative transfer protein TrbC | - |
| LQ157_RS24825 (48198) | 48198..49268 | - | 1071 | WP_000151582.1 | IncI1-type conjugal transfer protein TrbB | - |
| LQ157_RS24830 (49287) | 49287..50495 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (50675) | 50675..50732 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (50675) | 50675..50732 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (50675) | 50675..50732 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (50675) | 50675..50732 | - | 58 | NuclAT_0 | - | Antitoxin |
| LQ157_RS24835 (50787) | 50787..50939 | + | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
| LQ157_RS24840 (51011) | 51011..51262 | - | 252 | WP_001291965.1 | hypothetical protein | - |
| LQ157_RS25465 (51761) | 51761..51856 | + | 96 | WP_001303310.1 | DinQ-like type I toxin DqlB | - |
| LQ157_RS24850 (51921) | 51921..52097 | - | 177 | WP_001054897.1 | hypothetical protein | - |
| LQ157_RS24855 (52489) | 52489..52698 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| LQ157_RS24860 (52770) | 52770..53420 | - | 651 | WP_001178506.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| LQ157_RS24865 (53494) | 53494..55662 | - | 2169 | WP_000698357.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B | - | 1..97252 | 97252 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T295593 WP_001303307.1 NZ_OW848982:50787-50939 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT295593 NZ_OW848982:c50732-50675 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|