Detailed information of TA system TA295589

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 99809..100235
• Replicon: plasmid P1
• Accession: NZ_OW848981
• Organism: Escherichia coli isolate 23

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: LQ157_RS24370
• Protein ID: WP_001372321.1
• Coordinates: 99809..99934 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	100011..100235 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
LQ157_RS24330 (95183)	95183..95872	-	690	WP_015918718.1	conjugal transfer transcriptional regulator TraJ	-
LQ157_RS24335 (96059)	96059..96442	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
LQ157_RS24340 (96763)	96763..97365	+	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
LQ157_RS24345 (97662)	97662..98483	-	822	WP_001234426.1	DUF932 domain-containing protein	-
LQ157_RS24350 (98601)	98601..98888	-	288	WP_000107535.1	hypothetical protein	-
LQ157_RS24355 (98913)	98913..99119	-	207	WP_000547968.1	hypothetical protein	-
LQ157_RS24360 (99189)	99189..99361	+	173	Protein_111	hypothetical protein	-
LQ157_RS24365 (99359)	99359..99589	-	231	WP_071586998.1	hypothetical protein	-
LQ157_RS24370 (99809)	99809..99934	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
LQ157_RS24375 (99876)	99876..100025	-	150	Protein_114	plasmid maintenance protein Mok	-
- (100011)	100011..100235	-	225	NuclAT_0	-	Antitoxin
- (100011)	100011..100235	-	225	NuclAT_0	-	Antitoxin
- (100011)	100011..100235	-	225	NuclAT_0	-	Antitoxin
- (100011)	100011..100235	-	225	NuclAT_0	-	Antitoxin
LQ157_RS24380 (100047)	100047..100235	+	189	WP_001299721.1	hypothetical protein	-
LQ157_RS24385 (100204)	100204..100966	-	763	Protein_116	plasmid SOS inhibition protein A	-
LQ157_RS24390 (100963)	100963..101397	-	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
LQ157_RS24395 (101452)	101452..101649	-	198	Protein_118	hypothetical protein	-
LQ157_RS24400 (101677)	101677..101910	-	234	WP_000005990.1	DUF905 family protein	-
LQ157_RS24405 (101978)	101978..102517	-	540	WP_000290840.1	single-stranded DNA-binding protein	-
LQ157_RS24410 (102543)	102543..102749	-	207	WP_000275856.1	hypothetical protein	-
LQ157_RS24415 (102819)	102819..102899	+	81	Protein_122	hypothetical protein	-
LQ157_RS24420 (103082)	103082..103251	-	170	Protein_123	hypothetical protein	-
LQ157_RS24425 (103845)	103845..104816	-	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	tet(A) / sul2 / aph(3'')-Ib / aph(6)-Id / dfrA1 / ant(3'')-Ia / qacE / sul1 / mph(B) / sitABCD	iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA	1..125197	125197

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T295589 WP_001372321.1 NZ_OW848981:c99934-99809 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT295589 NZ_OW848981:c100235-100011 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin