Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 78936..79190 | Replicon | plasmid P1 |
| Accession | NZ_OW848981 | ||
| Organism | Escherichia coli isolate 23 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | LQ157_RS24220 | Protein ID | WP_001312851.1 |
| Coordinates | 78936..79085 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 79129..79190 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ157_RS24180 (74487) | 74487..74888 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| LQ157_RS24185 (74821) | 74821..75078 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| LQ157_RS24190 (75171) | 75171..75824 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| LQ157_RS24195 (76764) | 76764..77621 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| LQ157_RS24200 (77614) | 77614..78096 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| LQ157_RS24205 (78089) | 78089..78136 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| LQ157_RS24210 (78127) | 78127..78378 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| LQ157_RS24215 (78395) | 78395..78652 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| LQ157_RS24220 (78936) | 78936..79085 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (79129) | 79129..79190 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (79129) | 79129..79190 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (79129) | 79129..79190 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (79129) | 79129..79190 | + | 62 | NuclAT_1 | - | Antitoxin |
| LQ157_RS24225 (79446) | 79446..79520 | - | 75 | Protein_84 | endonuclease | - |
| LQ157_RS24230 (79766) | 79766..79978 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| LQ157_RS24235 (80114) | 80114..80674 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| LQ157_RS24240 (80777) | 80777..81637 | - | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
| LQ157_RS24245 (81696) | 81696..82442 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / sul2 / aph(3'')-Ib / aph(6)-Id / dfrA1 / ant(3'')-Ia / qacE / sul1 / mph(B) / sitABCD | iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA | 1..125197 | 125197 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T295584 WP_001312851.1 NZ_OW848981:c79085-78936 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT295584 NZ_OW848981:79129-79190 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
