Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 777672..778365 | Replicon | chromosome |
Accession | NZ_OW848980 | ||
Organism | Escherichia coli isolate 23 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | LQ157_RS03795 | Protein ID | WP_000415584.1 |
Coordinates | 777672..777968 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | LQ157_RS03800 | Protein ID | WP_000650107.1 |
Coordinates | 777970..778365 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ157_RS03765 (773347) | 773347..773661 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
LQ157_RS03770 (773692) | 773692..774273 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
LQ157_RS03775 (774383) | 774383..775732 | - | 1350 | WP_000673406.1 | quorum sensing histidine kinase QseC | - |
LQ157_RS03780 (775729) | 775729..776388 | - | 660 | WP_001221491.1 | quorum sensing response regulator transcription factor QseB | - |
LQ157_RS03785 (776540) | 776540..776932 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
LQ157_RS03790 (776985) | 776985..777467 | + | 483 | WP_000183494.1 | GyrI-like domain-containing protein | - |
LQ157_RS03795 (777672) | 777672..777968 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
LQ157_RS03800 (777970) | 777970..778365 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
LQ157_RS03805 (778498) | 778498..780105 | + | 1608 | WP_001701096.1 | ABC transporter substrate-binding protein | - |
LQ157_RS03810 (780243) | 780243..782501 | + | 2259 | WP_024249834.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 765944..778365 | 12421 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T295567 WP_000415584.1 NZ_OW848980:777672-777968 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT295567 WP_000650107.1 NZ_OW848980:777970-778365 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|