Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 2587193..2587755 | Replicon | chromosome |
| Accession | NZ_OW848788 | ||
| Organism | Citrobacter freundii isolate 112 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A8B5QCT4 |
| Locus tag | LQ087_RS12805 | Protein ID | WP_003836234.1 |
| Coordinates | 2587477..2587755 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A8B5QC60 |
| Locus tag | LQ087_RS12800 | Protein ID | WP_003836231.1 |
| Coordinates | 2587193..2587477 (-) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ087_RS12785 (2584884) | 2584884..2585768 | + | 885 | WP_003836226.1 | formate dehydrogenase N subunit beta | - |
| LQ087_RS12790 (2585761) | 2585761..2586417 | + | 657 | WP_003020054.1 | formate dehydrogenase-N subunit gamma | - |
| LQ087_RS12795 (2586547) | 2586547..2587149 | + | 603 | WP_054528391.1 | inorganic diphosphatase | - |
| LQ087_RS12800 (2587193) | 2587193..2587477 | - | 285 | WP_003836231.1 | HigA family addiction module antitoxin | Antitoxin |
| LQ087_RS12805 (2587477) | 2587477..2587755 | - | 279 | WP_003836234.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LQ087_RS12810 (2587976) | 2587976..2589691 | - | 1716 | WP_230121981.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
| LQ087_RS12815 (2590110) | 2590110..2591012 | + | 903 | WP_016150253.1 | endonuclease/exonuclease/phosphatase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10637.28 Da Isoelectric Point: 9.8965
>T295557 WP_003836234.1 NZ_OW848788:c2587755-2587477 [Citrobacter freundii]
MIMNFRHKGLRDLFLHGRTSGVMAKHVRRLRHRLAVIDAASKVTDINMPGYKLHPLVGDRDGIWAIAVSGNWRITFEFVN
GDAYILDYEDYH
MIMNFRHKGLRDLFLHGRTSGVMAKHVRRLRHRLAVIDAASKVTDINMPGYKLHPLVGDRDGIWAIAVSGNWRITFEFVN
GDAYILDYEDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B5QCT4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B5QC60 |