Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 346946..347612 | Replicon | chromosome |
| Accession | NZ_OW848788 | ||
| Organism | Citrobacter freundii isolate 112 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A8B5Q945 |
| Locus tag | LQ087_RS01640 | Protein ID | WP_003847996.1 |
| Coordinates | 347295..347612 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A4U6IRD5 |
| Locus tag | LQ087_RS01635 | Protein ID | WP_003837894.1 |
| Coordinates | 346946..347242 (-) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ087_RS01615 (342897) | 342897..343370 | - | 474 | WP_003023524.1 | transcription elongation factor GreB | - |
| LQ087_RS01620 (343632) | 343632..344752 | + | 1121 | WP_085950818.1 | IS3-like element ISSen4 family transposase | - |
| LQ087_RS01625 (344821) | 344821..345540 | + | 720 | WP_001157751.1 | two-component system response regulator OmpR | - |
| LQ087_RS01630 (345537) | 345537..346889 | + | 1353 | WP_230121619.1 | two-component system sensor histidine kinase EnvZ | - |
| LQ087_RS01635 (346946) | 346946..347242 | - | 297 | WP_003837894.1 | NadS family protein | Antitoxin |
| LQ087_RS01640 (347295) | 347295..347612 | - | 318 | WP_003847996.1 | hypothetical protein | Toxin |
| LQ087_RS01645 (347735) | 347735..349357 | - | 1623 | WP_003023529.1 | phosphoenolpyruvate carboxykinase (ATP) | - |
| LQ087_RS01650 (349736) | 349736..351454 | + | 1719 | WP_230121620.1 | DUF4153 domain-containing protein | - |
| LQ087_RS01655 (351564) | 351564..352442 | - | 879 | WP_003023531.1 | Hsp33 family molecular chaperone HslO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12225.15 Da Isoelectric Point: 10.0909
>T295550 WP_003847996.1 NZ_OW848788:c347612-347295 [Citrobacter freundii]
MFTFIELQGFSKRRPLLLPDDEFRAFQEALIENPEAGDTIAGTGGFRKIRWSRSGMGKRSGIRVIYYNVTRKGRIYLALL
YPKNEQDDLTEEQKRVLMHLSNMLI
MFTFIELQGFSKRRPLLLPDDEFRAFQEALIENPEAGDTIAGTGGFRKIRWSRSGMGKRSGIRVIYYNVTRKGRIYLALL
YPKNEQDDLTEEQKRVLMHLSNMLI
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B5Q945 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4U6IRD5 |