Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 44530..45178 | Replicon | chromosome |
Accession | NZ_OW848788 | ||
Organism | Citrobacter freundii isolate 112 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A0D7M266 |
Locus tag | LQ087_RS00205 | Protein ID | WP_016151211.1 |
Coordinates | 44530..44892 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A0D7LEH2 |
Locus tag | LQ087_RS00210 | Protein ID | WP_003840660.1 |
Coordinates | 44879..45178 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ087_RS00190 (40989) | 40989..42317 | + | 1329 | WP_003023927.1 | MFS transporter | - |
LQ087_RS00195 (42460) | 42460..43851 | + | 1392 | WP_003023929.1 | hexose-6-phosphate:phosphate antiporter | - |
LQ087_RS00200 (43977) | 43977..44429 | + | 453 | WP_003023933.1 | DUF1198 family protein | - |
LQ087_RS00205 (44530) | 44530..44892 | + | 363 | WP_016151211.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LQ087_RS00210 (44879) | 44879..45178 | + | 300 | WP_003840660.1 | XRE family transcriptional regulator | Antitoxin |
LQ087_RS00215 (45297) | 45297..46487 | + | 1191 | WP_032937137.1 | purine ribonucleoside efflux pump NepI | - |
LQ087_RS00220 (46536) | 46536..47918 | - | 1383 | WP_200014706.1 | glycoside hydrolase family 1 protein | - |
LQ087_RS00225 (48013) | 48013..48306 | - | 294 | WP_003840665.1 | YicS family protein | - |
LQ087_RS00230 (48437) | 48437..48853 | + | 417 | WP_003844473.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13788.66 Da Isoelectric Point: 5.1976
>T295548 WP_016151211.1 NZ_OW848788:44530-44892 [Citrobacter freundii]
MWEVETTDAFDKWFDVQTEALKEDMLAAMMILSEYGPQLGRPFADTVNASAFSNMKELRVQHQGSPIRAFFAFDPSRHGI
VLCAGDKTGLNEKKFYKEMIRLADAEYRNHLISKENYGYP
MWEVETTDAFDKWFDVQTEALKEDMLAAMMILSEYGPQLGRPFADTVNASAFSNMKELRVQHQGSPIRAFFAFDPSRHGI
VLCAGDKTGLNEKKFYKEMIRLADAEYRNHLISKENYGYP
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0D7M266 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0D7LEH2 |