Detailed information of TA system TA295541

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 54881..55307
• Replicon: plasmid P1
• Accession: NZ_OW848786
• Organism: Escherichia coli isolate 131

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: LQ117_RS24945
• Protein ID: WP_001372321.1
• Coordinates: 54881..55006 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	55083..55307 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
LQ117_RS24905 (49920)	49920..50147	-	228	WP_001254388.1	conjugal transfer relaxosome protein TraY	-
LQ117_RS24910 (50241)	50241..50927	-	687	WP_000332487.1	PAS domain-containing protein	-
LQ117_RS24915 (51121)	51121..51504	-	384	WP_001151564.1	conjugal transfer relaxosome DNA-binding protein TraM	-
LQ117_RS24920 (51790)	51790..52437	+	648	WP_000614282.1	transglycosylase SLT domain-containing protein	-
LQ117_RS24925 (52734)	52734..53555	-	822	WP_001234469.1	DUF932 domain-containing protein	-
LQ117_RS24930 (53675)	53675..53962	-	288	WP_000107537.1	hypothetical protein	-
LQ117_RS24935 (54260)	54260..54433	+	174	Protein_63	hypothetical protein	-
LQ117_RS24940 (54431)	54431..54661	-	231	WP_071587244.1	hypothetical protein	-
LQ117_RS24945 (54881)	54881..55006	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
LQ117_RS24950 (54948)	54948..55097	-	150	Protein_66	plasmid maintenance protein Mok	-
- (55083)	55083..55307	-	225	NuclAT_0	-	Antitoxin
- (55083)	55083..55307	-	225	NuclAT_0	-	Antitoxin
- (55083)	55083..55307	-	225	NuclAT_0	-	Antitoxin
- (55083)	55083..55307	-	225	NuclAT_0	-	Antitoxin
LQ117_RS24955 (55119)	55119..55307	+	189	WP_001299721.1	hypothetical protein	-
LQ117_RS24960 (55276)	55276..56038	-	763	Protein_68	plasmid SOS inhibition protein A	-
LQ117_RS24965 (56035)	56035..56469	-	435	WP_000845901.1	conjugation system SOS inhibitor PsiB	-
LQ117_RS24970 (56524)	56524..58482	-	1959	WP_001145469.1	ParB/RepB/Spo0J family partition protein	-
LQ117_RS24975 (58541)	58541..58774	-	234	WP_000006004.1	DUF905 domain-containing protein	-
LQ117_RS24980 (58830)	58830..59357	-	528	WP_000290793.1	single-stranded DNA-binding protein	-
LQ117_RS24985 (59827)	59827..60069	-	243	WP_001365577.1	hypothetical protein	-
LQ117_RS24990 (59997)	59997..60221	-	225	WP_021538344.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	aac(6')-Ib-cr / blaOXA-1	-	1..109001	109001

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T295541 WP_001372321.1 NZ_OW848786:c55006-54881 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT295541 NZ_OW848786:c55307-55083 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin