295537

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4966425..4966646 Replicon chromosome
Accession NZ_OW848785
Organism Escherichia coli isolate 131

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag LQ117_RS24175 Protein ID WP_001531632.1
Coordinates 4966425..4966532 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4966580..4966646 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ117_RS24150 (4962269) 4962269..4963351 + 1083 WP_000804726.1 peptide chain release factor 1 -
LQ117_RS24155 (4963351) 4963351..4964184 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
LQ117_RS24160 (4964181) 4964181..4964573 + 393 WP_000200375.1 invasion regulator SirB2 -
LQ117_RS24165 (4964577) 4964577..4965386 + 810 WP_001257044.1 invasion regulator SirB1 -
LQ117_RS24170 (4965422) 4965422..4966276 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
LQ117_RS24175 (4966425) 4966425..4966532 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4966582) 4966582..4966645 + 64 NuclAT_12 - -
- (4966582) 4966582..4966645 + 64 NuclAT_12 - -
- (4966582) 4966582..4966645 + 64 NuclAT_12 - -
- (4966582) 4966582..4966645 + 64 NuclAT_12 - -
- (4966582) 4966582..4966645 + 64 NuclAT_13 - -
- (4966582) 4966582..4966645 + 64 NuclAT_13 - -
- (4966582) 4966582..4966645 + 64 NuclAT_13 - -
- (4966582) 4966582..4966645 + 64 NuclAT_13 - -
- (4966582) 4966582..4966645 + 64 NuclAT_14 - -
- (4966582) 4966582..4966645 + 64 NuclAT_14 - -
- (4966582) 4966582..4966645 + 64 NuclAT_14 - -
- (4966582) 4966582..4966645 + 64 NuclAT_14 - -
- (4966582) 4966582..4966645 + 64 NuclAT_15 - -
- (4966582) 4966582..4966645 + 64 NuclAT_15 - -
- (4966582) 4966582..4966645 + 64 NuclAT_15 - -
- (4966582) 4966582..4966645 + 64 NuclAT_15 - -
- (4966582) 4966582..4966645 + 64 NuclAT_16 - -
- (4966582) 4966582..4966645 + 64 NuclAT_16 - -
- (4966582) 4966582..4966645 + 64 NuclAT_16 - -
- (4966582) 4966582..4966645 + 64 NuclAT_16 - -
- (4966582) 4966582..4966645 + 64 NuclAT_17 - -
- (4966582) 4966582..4966645 + 64 NuclAT_17 - -
- (4966582) 4966582..4966645 + 64 NuclAT_17 - -
- (4966582) 4966582..4966645 + 64 NuclAT_17 - -
- (4966580) 4966580..4966646 + 67 NuclAT_10 - Antitoxin
- (4966580) 4966580..4966646 + 67 NuclAT_10 - Antitoxin
- (4966580) 4966580..4966646 + 67 NuclAT_10 - Antitoxin
- (4966580) 4966580..4966646 + 67 NuclAT_10 - Antitoxin
- (4966580) 4966580..4966646 + 67 NuclAT_5 - Antitoxin
- (4966580) 4966580..4966646 + 67 NuclAT_5 - Antitoxin
- (4966580) 4966580..4966646 + 67 NuclAT_5 - Antitoxin
- (4966580) 4966580..4966646 + 67 NuclAT_5 - Antitoxin
- (4966580) 4966580..4966646 + 67 NuclAT_6 - Antitoxin
- (4966580) 4966580..4966646 + 67 NuclAT_6 - Antitoxin
- (4966580) 4966580..4966646 + 67 NuclAT_6 - Antitoxin
- (4966580) 4966580..4966646 + 67 NuclAT_6 - Antitoxin
- (4966580) 4966580..4966646 + 67 NuclAT_7 - Antitoxin
- (4966580) 4966580..4966646 + 67 NuclAT_7 - Antitoxin
- (4966580) 4966580..4966646 + 67 NuclAT_7 - Antitoxin
- (4966580) 4966580..4966646 + 67 NuclAT_7 - Antitoxin
- (4966580) 4966580..4966646 + 67 NuclAT_8 - Antitoxin
- (4966580) 4966580..4966646 + 67 NuclAT_8 - Antitoxin
- (4966580) 4966580..4966646 + 67 NuclAT_8 - Antitoxin
- (4966580) 4966580..4966646 + 67 NuclAT_8 - Antitoxin
- (4966580) 4966580..4966646 + 67 NuclAT_9 - Antitoxin
- (4966580) 4966580..4966646 + 67 NuclAT_9 - Antitoxin
- (4966580) 4966580..4966646 + 67 NuclAT_9 - Antitoxin
- (4966580) 4966580..4966646 + 67 NuclAT_9 - Antitoxin
- (4966582) 4966582..4966647 + 66 NuclAT_18 - -
- (4966582) 4966582..4966647 + 66 NuclAT_18 - -
- (4966582) 4966582..4966647 + 66 NuclAT_18 - -
- (4966582) 4966582..4966647 + 66 NuclAT_18 - -
- (4966582) 4966582..4966647 + 66 NuclAT_19 - -
- (4966582) 4966582..4966647 + 66 NuclAT_19 - -
- (4966582) 4966582..4966647 + 66 NuclAT_19 - -
- (4966582) 4966582..4966647 + 66 NuclAT_19 - -
- (4966582) 4966582..4966647 + 66 NuclAT_20 - -
- (4966582) 4966582..4966647 + 66 NuclAT_20 - -
- (4966582) 4966582..4966647 + 66 NuclAT_20 - -
- (4966582) 4966582..4966647 + 66 NuclAT_20 - -
- (4966582) 4966582..4966647 + 66 NuclAT_21 - -
- (4966582) 4966582..4966647 + 66 NuclAT_21 - -
- (4966582) 4966582..4966647 + 66 NuclAT_21 - -
- (4966582) 4966582..4966647 + 66 NuclAT_21 - -
- (4966582) 4966582..4966647 + 66 NuclAT_22 - -
- (4966582) 4966582..4966647 + 66 NuclAT_22 - -
- (4966582) 4966582..4966647 + 66 NuclAT_22 - -
- (4966582) 4966582..4966647 + 66 NuclAT_22 - -
- (4966582) 4966582..4966647 + 66 NuclAT_23 - -
- (4966582) 4966582..4966647 + 66 NuclAT_23 - -
- (4966582) 4966582..4966647 + 66 NuclAT_23 - -
- (4966582) 4966582..4966647 + 66 NuclAT_23 - -
LQ117_RS24180 (4966937) 4966937..4968037 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
LQ117_RS24185 (4968307) 4968307..4968546 + 240 WP_000120702.1 putative cation transport regulator ChaB -
LQ117_RS24190 (4968695) 4968695..4969390 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
LQ117_RS24195 (4969434) 4969434..4969787 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
LQ117_RS24200 (4969972) 4969972..4971366 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T295537 WP_001531632.1 NZ_OW848785:c4966532-4966425 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT295537 NZ_OW848785:4966580-4966646 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References