Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 4114986..4115665 | Replicon | chromosome |
Accession | NZ_OW848785 | ||
Organism | Escherichia coli isolate 131 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1PK60 |
Locus tag | LQ117_RS19785 | Protein ID | WP_000057523.1 |
Coordinates | 4114986..4115288 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | LQ117_RS19790 | Protein ID | WP_000806442.1 |
Coordinates | 4115324..4115665 (+) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ117_RS19760 (4110362) | 4110362..4112014 | + | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
LQ117_RS19765 (4112052) | 4112052..4112555 | - | 504 | WP_000667000.1 | hypothetical protein | - |
LQ117_RS19770 (4112552) | 4112552..4113352 | - | 801 | WP_000439798.1 | hypothetical protein | - |
LQ117_RS19775 (4113376) | 4113376..4113855 | - | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
LQ117_RS19780 (4114059) | 4114059..4114853 | - | 795 | WP_000365147.1 | TraB/GumN family protein | - |
LQ117_RS19785 (4114986) | 4114986..4115288 | + | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LQ117_RS19790 (4115324) | 4115324..4115665 | + | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
LQ117_RS19795 (4115723) | 4115723..4118227 | - | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
LQ117_RS19800 (4118489) | 4118489..4119421 | + | 933 | WP_000883041.1 | glutaminase A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T295536 WP_000057523.1 NZ_OW848785:4114986-4115288 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|